KEGG   Vibrio vulnificus YJ016: VV0185Help
Entry
VV0185            CDS       T00150                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vvy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:194211..195254
Genome map
AA seq 347 aa AA seqDB search
MSVSIQGPFPARRMRRMRKHEFSRRLMAENQLSVSDLIYPMFILMGKDRRESVESMPGVE
RLSIDLMLEEAQYLAQLGVPAIALFPVVNQDAKSLCAAEAYNPEGLVQRAVRALKEHVPA
MGVITDVALDPFTTHGQDGIIDEEGYVMNDETTEVLIKQALSHAEAGADVVAPSDMMDGR
IGRIRDALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSASNLKGGNKKNYQMDPANSDE
ALHEVALDINEGADMVMVKPGMPYLDVVRRVKTELQVPTFAYQVSGEYAMHKAAIQNGWL
KERETVLESLLCFKRAGADGILTYFAKDVAQWLAEDNAQAAQFLKTE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtatctattcaaggcccattcccagcgcgccgtatgcgccgtatgcgcaagcat
gagttcagtcgtcgtttgatggcggagaatcagctatcggttagcgacttgatctacccg
atgtttatcttaatgggtaaagatcgtcgtgagagtgttgaatctatgcctggcgtagag
cgcctttccattgacttgatgcttgaagaagcacagtaccttgctcagcttggtgtgcca
gcgattgctcttttccctgtggtgaatcaagacgcgaaaagcctttgtgccgcggaagct
tataatcctgaaggcttggttcagagagcagtgcgtgcattaaaagagcacgtgccagca
atgggcgtcattacagacgttgcacttgatccttttaccacccatggtcaagacggcatc
attgatgaagaaggctatgtgatgaatgatgagacaacggaagttctgatcaaacaagcg
ttgtcgcatgcggaagcgggtgcggatgtagtggccccctcagatatgatggatggtcga
attggccgtatccgtgacgctctagaggaagcgggttacattcatactcaaatcatggct
tactccgccaaatacgcatccaactactacgggccattccgtgatgcggtgggctctgca
tccaacctaaaaggtggaaacaaaaagaactaccaaatggatcccgccaacagcgatgaa
gcgttgcacgaagtagcattagacattaatgaaggtgccgatatggtgatggtgaagccg
ggcatgccatacctcgatgttgtacgccgtgttaaaacagagcttcaagtaccgacattc
gcctatcaagtgtcgggcgaatatgcgatgcacaaagccgcgattcaaaatggttggttg
aaagagcgtgaaacggtgttggaatcgttgctttgctttaaaagagcgggtgcggatggc
attttgacttactttgccaaagatgtcgcacaatggttagcggaagacaatgcgcaagcg
gcgcaattcttgaaaaccgaatag

DBGET integrated database retrieval system