KEGG   Vibrio vulnificus YJ016: VV0243Help
Entry
VV0243            CDS       T00150                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00230  Purine metabolism
vvy01100  Metabolic pathways
Module
vvy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VV0243
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VV0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 ABC_tran RsgA_GTPase AAA_16 AAA_22 CPT MMR_HSR1 AAA_29 cobW
Motif
Other DBs
NCBI-ProteinID: BAC93007
UniProt: Q7MPW9
Position
I:complement(252786..253409)
Genome map
AA seq 207 aa AA seqDB search
MGKGTLYIVSAPSGAGKSSLISAMLEKNPTYAMKVSVSHTTRGMRPGEQDGVHYHFVEKE
HFEDLITKGEFLEYAEVFGNYYGTSRVWIENTLDKGIDVFLDIDWQGARQIREQMPHAKS
IFILPPSNGELERRLNTRGQDSEAVIAKRMAEAKSEISHYNEYDYVIINDDFDTALMDFK
AIIRAERLKQDKQAAKYSGMLDALLAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtactctttacatcgtctctgctccaagcggtgcaggcaaatccagctta
atctccgcgatgctggagaaaaacccgacttacgcaatgaaagtgtcggtctctcacacc
acacgtggcatgcgcccaggtgaacaagatggcgtgcactaccactttgtcgagaaagag
cattttgaagatctgattaccaaaggcgagtttctggaatacgcagaagtgtttggtaac
tactacggcacctcacgtgtttggattgaaaacaccctagataaaggcattgatgttttt
ctcgatatcgattggcaaggcgctcgtcaaattcgtgagcaaatgccacacgctaagagc
atctttatcttaccaccatccaacggtgaacttgagcgtcgtcttaatacacgcggtcaa
gacagcgaagcggtgatcgccaagcgcatggcagaagcgaaatccgaaatctcgcactac
aacgaatacgattacgtgatcatcaacgatgatttcgatactgctttgatggactttaaa
gccattatccgagcagaaagattgaagcaagacaaacaagctgctaaatatagcggtatg
cttgacgcgcttttagcggaataa

DBGET integrated database retrieval system