KEGG   Vibrio vulnificus YJ016: VV0303Help
Entry
VV0303            CDS       T00150                                 

Definition
dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    VV0303
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VV0303
Enzymes [BR:vvy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     VV0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:312253..312810
Genome map
AA seq 185 aa AA seqDB search
MKVIETSIPEIKIIEPMVFGDERGFFMETWHQARFEELVTGKPTRFVQDNHSKSKQGILR
GLHYQMQHTQGKLVRVVSGEVFDVAVDIRQGSPTFGQWVGVYLSAENKRQMWVPEGFAHG
FYVTSEEAEFVYKCTDYYHPQSEQCIAWNDTVIGIDWPIPIGKGPMLSKKDASAPNLSEC
KYLLG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgatagagaccagtattcccgagatcaaaattattgagccaatggtctttggt
gatgagcgcggtttttttatggaaacctggcatcaggcgcgatttgaagaacttgttaca
ggcaaaccaactcgatttgtccaagataatcattccaaatcaaagcaaggcatcctacga
ggcttgcattatcagatgcaacatactcaaggcaagctagtacgtgttgtttccggtgag
gtgtttgatgttgcagtggatattcggcagggctcgccgacctttggtcagtgggttggg
gtctatctatcggctgaaaacaaacgtcaaatgtgggtgcctgagggctttgcccacggc
ttttacgtgaccagcgaagaggctgagttcgtctacaaatgcaccgattactaccatcca
caatcggaacaatgcattgcttggaacgatactgtgattggcattgactggccaatacct
ataggtaaagggccaatgctatcaaagaaagatgcatcagctccaaatctatctgaatgt
aaatatcttttaggatag

DBGET integrated database retrieval system