KEGG   Vibrio vulnificus YJ016: VV0461Help
Entry
VV0461            CDS       T00150                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vvy00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vvy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:446445..447710
Genome map
AA seq 421 aa AA seqDB search
MEKFRVIGSTQPLMGEVTISGAKNAALPILFASILAEEPVEVANVPHLRDIDTTMELLKR
LGAKVERNGSVHVDPSSIDEYCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGA
RPVDLHITGLEQLGATITLEDGYVKAHVDGRLQGAHIVMDKVSVGATITIMCAATLAEGT
TVLDNAAREPEIVDTAKFLNTLGAKISGAGTDTITIEGVERLGGGKHAVVADRIETGTFL
VAAAVSGGKVVCHNTQAHLLEAVLAKLEEAGALVETGEDWISVDMTGRELKAVNIRTAPH
PGFPTDMQAQFTLLNMMAKGGGVITETIFENRFMHVPELKRMGAKAEIEGNTVICGDVER
LSAAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRGYDKIENKLNALGAKIERFRES
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttccgtgtaattgggtcgactcagccattgatgggtgaggtgactatttca
ggtgccaaaaacgctgcactgccgattttatttgcgtcgattctggctgaagagccagtt
gaagtggccaatgtgccgcatcttcgagatattgataccaccatggagctgctaaagcgc
cttggtgccaaagtggaacgaaatggttccgttcatgttgaccctagctctatcgatgaa
tattgcgcgccttatgatttggtgaaaaccatgcgtgcatcgatctgggcattagggccg
cttgttgctcgtttcggtcaaggacaagtgtctctgccgggtggttgtgcgatcggtgct
cgtcccgtggatttacacatcactggtcttgagcaactaggtgccaccatcacattagaa
gatggttacgttaaagcgcatgtcgacggccgtttacaaggcgcacacattgtcatggac
aaagtgagcgtaggtgccacgatcaccatcatgtgtgcagccacacttgccgaaggcacg
acggttttagataacgcagcgcgtgagccagaaattgtcgataccgcgaaattcctcaac
acgcttggggctaaaatcagcggtgcaggcactgacaccatcaccattgagggcgttgaa
cgtctgggtggtggtaagcatgccgtggtggcagaccgcatcgaaacggggactttcctt
gttgctgcagcggtgtctggcggtaaagtcgtttgccacaatacgcaagcgcatttactt
gaagccgtgttggcgaagttggaagaagcgggcgccttggttgaaactggtgaagattgg
atttctgtcgatatgacaggtcgagagctcaaagcggtcaatatccgcacggcgcctcac
ccgggtttcccgaccgatatgcaagcacagtttaccttgctgaatatgatggcgaaaggc
ggtggtgtgatcactgaaaccatctttgaaaaccgtttcatgcatgttccagagctaaaa
cgtatgggtgcaaaagcggagattgaaggtaacactgtcatctgtggtgacgtggagcgt
ttgagcgcagcacaagttatggcgaccgatctacgagcgtcagccagcttagtgattgca
ggttgtatcgctaagggtgaaaccatcgttgatcgcatttaccacattgaccgtggctac
gacaaaatcgagaacaagcttaatgcactgggtgcaaagattgagcgttttcgtgagtca
aactaa

DBGET integrated database retrieval system