KEGG   Vibrio vulnificus YJ016: VV0475Help
Entry
VV0475            CDS       T00150                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VV0475
   00670 One carbon pool by folate
    VV0475
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VV0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:459740..460228
Genome map
AA seq 162 aa AA seqDB search
MIISMIAAMAKQRIIGKDNQMPWHLPADFAWFKRCTMGKPVVMGRKTYDSIGRPLPGRLN
IVISRDESLVIEGVTMANSIAHALALAGDADEVMIIGGGSIYAECLPKADKLYLTFIDAT
IDGDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILERDNC
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcagtatgattgccgcgatggcaaagcaaagaatcattggtaaagataaccag
atgccttggcatcttcccgcagattttgcttggttcaaacgctgcacgatggggaaaccg
gtcgtgatggggcgtaaaacgtatgattcgatcggacgtccgttgccagggcgattgaat
atagtgattagtcgtgacgaaagcttggttattgagggggtcactatggccaactcgatt
gcgcatgccttagcgttagcgggggatgcagatgaagtgatgatcatcggtggcggttca
atttacgctgagtgtttaccaaaagcagacaaactctatctgacgtttatcgatgccact
attgatggcgatactcagtttcctgattggggggagcaatggtgcgagagccatcgcgaa
cactattctgctgatgagaaaaatcgctacgcgatggattttgttattttagaaagagat
aattgctag

DBGET integrated database retrieval system