KEGG   Vibrio vulnificus YJ016: VV0528Help
Entry
VV0528            CDS       T00150                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VV0528
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VV0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:511102..512031
Genome map
AA seq 309 aa AA seqDB search
MKTIAVIGSNMVDLISYTDRMPKEGETLEAPSFKMGCGGKGANQAVAAAKMGADVVMVSK
VGDDMFADNTIRNFQSYGINTQYVSKVPQTSSGVAPIFVNSTSQNSILIIKGANEFLKPD
DIDKAESTLVECSLIVLQLEVPLETVYAAIEFGNKHSIPVLLNPAPAVPELDIEYACRCD
FFVPNETELEILVNKPVETVEQIKEAATILLNKGLNNIIVTMGSKGALWLSKDGKDVFIE
PTKVNAVDTSGAGDAFIGCFSHYFMQTGDVQKSLEKASLFAAFSVTEKGTQFSYPSIEQF
EEFETKHSK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgcagttatcggctcaaatatggttgatctcatttcatacacagaccgt
atgccaaaagaaggtgaaacattagaagctccatcattcaaaatgggatgtggtgggaaa
ggtgctaaccaagccgtagccgctgcgaaaatgggagcagatgttgtaatggtaagcaaa
gtgggtgacgacatgtttgccgacaatacgattcgaaactttcaatcttacggcatcaac
actcaatatgtgagcaaagtacctcagacttcaagcggtgtggcaccaatatttgttaac
tccacatctcagaactcaattttgatcattaaaggagctaacgagtttttaaaaccagat
gacattgataaagcagaaagtaccttggtggagtgcagtttgattgtacttcagctagaa
gtaccactggaaactgtctatgccgccatcgaatttggcaacaagcatagtattccggta
ttgctaaatcctgcacctgctgtacctgagcttgatattgaatatgcttgtcgttgtgat
ttcttcgtccctaacgaaactgaactagaaattctagtgaacaagcctgttgaaacggtt
gaacagattaaagaagcagccaccattcttctaaataaaggtttgaacaatatcatcgtt
accatgggttcgaaaggagcgctttggttaagcaaagatggtaaagacgtattcattgag
ccaaccaaagtaaatgcggtggataccagtggtgcgggggatgcattcattggctgcttc
tctcactactttatgcaaactggtgatgtacagaagtcattggaaaaagcttcactgttt
gctgcattcagtgtgacggaaaaaggaacacagttctcttatccgagcattgaacaattc
gaagagtttgaaacaaagcactctaaataa

DBGET integrated database retrieval system