KEGG   Vibrio vulnificus YJ016: VV0609Help
Entry
VV0609            CDS       T00150                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vvy00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vvy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:592898..594445
Genome map
AA seq 515 aa AA seqDB search
MWHPMKMHSRTSFMAERGSENKMRNTMNLTNLLAPWLDCPELADITVQSLELDSRQVKQG
DTFVAIVGHVVDGRQYIEKAIEQGANAVIAQSCQQYPPGLVRYQQNVVIVYLEKLDEKLS
QLAGRLYQHPEMSLIGVTGTNGKTTITQLIAQWLELAGQKAAVMGTTGNGFLNALQPAAN
TTGNAVEIQKTLADLQQQGAKATALEVSSHGLVQGRVKALQFAAGVFTNLSRDHLDYHGT
MEAYAKAKMTLFTEHQCQHAIINLDDEVGAQWFQELQQGVGVSLFPQDASVKALWASSVA
YAESGITIEFDGCFGQGRLHAPLIGEFNATNLLLALATLLALGVDKQALLDSAASLRPVL
GRMELFQVNSKAKVVVDYAHTPDALEKALQALRVHCTGHLWAIFGCGGDRDKGKRPMMAE
IAERLADHVVLTDDNPRSEDPAMIVQDMLAGLTRGDSAVVEHDRFSALQYALDNAQADDI
ILLAGKGHEDYQVLKHQTVHYSDRESAQQLLGISS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacccgatgaaaatgcattccagaactagttttatggctgagcgtggctcggag
aacaaaatgcgaaataccatgaatctgacaaatttattagcgccgtggctagattgtcct
gagcttgcggacattaccgtccaatcgctggagttagacagtcgtcaggtgaaacaaggc
gatacttttgtcgctatcgttggtcacgtggtggatggccgccagtatattgagaaagca
atagaacagggcgcaaatgccgtcattgctcaatcttgtcagcaataccctcccggcttg
gtgcgctatcagcaaaacgtggtgattgtctatcttgagaagctggacgaaaaactgtcg
caattagcgggacgcctgtaccaacatcctgagatgtcattaattggtgtgacaggaacc
aatggcaaaaccaccatcactcaattgattgcgcaatggctagagttagccgggcaaaaa
gccgcagtgatggggacgacgggcaacggttttctcaatgccttacagcctgcggccaat
accacgggcaatgcggttgagattcaaaaaacgttggcagacttacagcagcaaggggca
aaagcaactgcgttggaagtctcttctcatggcttagtgcaggggcgcgttaaggcgcta
cagtttgccgctggcgtgtttaccaatctgagccgtgatcatttggattatcacggcacg
atggaagcctatgccaaagccaaaatgacgctgtttactgagcaccagtgccagcatgca
atcatcaatctggatgacgaagtcggtgcgcagtggtttcaagagctgcaacaaggggtc
ggcgtttcattgtttccacaagatgcaagtgtaaaagcactgtgggccagctcggtagct
tacgcagaaagcggtattacgattgagtttgatggctgctttggccaagggcgtctgcac
gcgccattgattggtgaatttaatgccaccaacttactgctcgcgttggcaacactgcta
gccttaggcgttgataagcaagctttattggattcggccgcaagcctgcgcccagtactt
ggacgtatggaactgtttcaagtgaacagcaaagccaaagtggtggtcgattatgcccat
accccagatgcgctggagaaagcgctgcaagcactgcgtgttcactgtaccggtcatttg
tgggcgattttcggctgtggtggtgatcgcgataaaggcaagcgaccaatgatggcagag
attgcagagcgtctggccgatcacgtcgtgcttaccgacgacaacccacgcagtgaagac
cccgccatgattgtgcaagatatgctggcgggcttaactcgtggagacagtgcagtggtt
gagcacgatcgcttcagtgcgcttcaatacgcgctcgacaatgcacaagcggatgacatc
attttgttggcaggcaaaggccacgaagattatcaagtactcaagcaccagacggttcac
tactcggatcgtgaatcggcgcagcaactgctaggaatttcatcatga

DBGET integrated database retrieval system