KEGG   Vibrio vulnificus YJ016: VV0666Help
Entry
VV0666            CDS       T00150                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vvy  Vibrio vulnificus YJ016
Brite
Enzymes [BR:vvy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VV0666
Secretion system [BR:vvy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VV0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:661927..662721
Genome map
AA seq 264 aa AA seqDB search
MILMSVLRRLTLLTLPLFVTACGAEESQAVETAQPAAQVAASTHFDSEALKARFSKLGLN
IMDIQPSDVAGLVEIQTSGGVLFASKDGSHFIAGTLYSIDENGQYKDVIAERQAPLNAKK
IAEFADSAIEYKAKDEKYVVTVFTDITCGYCVRLHSQMQGYNDLGITVRYMAYPRQGGTG
PVAEQMAGIWCAANPQEAMHDAKVNRKFAPAKNDLQQCKQTVAQHYQLGQQLGITGTPAI
FLPNGELVAGYLPPEKLLERLQQP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgattttaatgagcgtattacgccgattaactcttttaactcttcctctctttgtgacg
gcctgcggtgctgaagaaagccaagcggtcgaaacagctcagccagcggcacaagtggcg
gcgagcacgcattttgatagcgaggctctcaaagctcgtttttccaagctgggcctgaac
atcatggatattcaaccttcggatgtggcgggtttagtcgaaattcaaaccagtggcggg
gtgttatttgcgtctaaagacggtagccactttatcgctggaaccttgtattccatcgac
gaaaatggtcaatacaaggacgtgatcgcagaacgccaagcgccgctcaacgccaagaaa
attgccgaatttgctgacagcgcgatcgagtacaaagccaaagatgaaaaatacgtggtg
acggtgtttaccgacattacttgcggttactgcgttcgtctacacagccagatgcagggc
tacaatgacttaggtatcaccgtgcgttacatggcatacccacgccaaggtggcacgggc
cctgtggcagaacaaatggcgggcatctggtgtgccgctaatccgcaagaagcgatgcat
gatgctaaagtgaaccgcaaatttgccccagcgaaaaatgatttacagcagtgcaagcag
accgtggctcaacattaccaacttggtcagcaactcggtattacaggcacgcctgcgatt
ttcttgccaaatggtgagctggttgctggttacttgccaccagaaaaactgctagaacgt
ttacagcaaccataa

DBGET integrated database retrieval system