KEGG   Vibrio vulnificus YJ016: VV0700Help
Entry
VV0700            CDS       T00150                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VV0700
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VV0700
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VV0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:698115..699101
Genome map
AA seq 328 aa AA seqDB search
MGPLWVDVAGYELNAEDKEILQHPSVGGLILFTRNYHDSEQLLALTAAIRQVVKRPFLIG
VDQEGGRVQRFRDGFSLIPAAAEYAKQANGEAMAQMGGWLMAAELIAHDIDLSFAPVLDQ
GFGCKAIGNRAFGEDTQTILRHSSAYMQGMKAVGMATTGKHFPGHGGVVADSHLETPFDQ
RSDIVEQDMAIFKTQIDAGLLDAMMPAHVIYPHYDPQPASGSEYWLKQVLRQQLGFKGLI
FSDDLTMEGAAVMGGPADRALQALNAGCDMLLMCNKRDAQVAALDALPIVEVPLALSLLK
KRSFSLSELKLAPQWKEARENMLRILGH
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggggccactttgggttgatgtcgcaggttatgaactgaatgcagaagacaaagaaatt
ttacagcatccatccgttggcggattgatcttatttacccgcaactatcacgatagtgaa
cagctgttggcgctcactgcggccattcgccaagtggtcaagcgtccttttctgattggc
gtcgaccaagagggagggcgagttcagcgtttccgtgatggtttttctctgattcccgcc
gcggcagaatatgccaaacaagccaatggggaagcgatggcacaaatgggcggttggctg
atggcggccgaactgattgctcatgatatcgacctgagttttgcccccgtgttagaccaa
ggctttggatgtaaagcgattggcaaccgagcgtttggtgaagatacgcagactattttg
cgccatagcagtgcctacatgcagggcatgaaagcggtggggatggcaacaacgggcaaa
cacttccctggtcatggcggcgtggtggcagattcgcatcttgaaaccccgtttgaccaa
cgaagcgatattgttgagcaggatatggcaatcttcaaaacgcaaatagacgcaggctta
ttagacgccatgatgcctgcgcatgtgatttacccgcattacgatcctcaaccagcgagt
ggttcagaatattggttaaaacaggtattacgccagcaattgggtttcaagggcttaatt
ttttctgatgatctcaccatggaaggggctgccgtgatgggaggccctgcagatagggct
ttacaagcattgaatgcgggctgtgacatgcttttgatgtgcaataaacgcgatgcacaa
gtggcagccttggacgcactgcctatcgtcgaggttcccttggcattatccttgttgaag
aaacgcagcttcagcctttctgaactgaaattggcgccgcaatggaaagaagcaagagaa
aacatgctacgcatactgggccactaa

DBGET integrated database retrieval system