KEGG   Vibrio vulnificus YJ016: VV0741Help
Entry
VV0741            CDS       T00150                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV0741
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV0741
   00630 Glyoxylate and dicarboxylate metabolism
    VV0741
Enzymes [BR:vvy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VV0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:746365..748017
Genome map
AA seq 550 aa AA seqDB search
MKGRRMMLAQTPEKENTQAEQQTQGMLEVTGTLSPEHQAIFPVEAQTFLSQLCERFSLRV
DQLLTAREERQNKIDQGELPDFLTETQDIREGSWKILGIPNDLQDRRVEITGPTDRKMVI
NALNANVKVFMADFEDSMSPAWDKVLDGQINLRDAVNGTISYSNPDNGKHYQLGNNPAVL
ICRVRGLHLKEKHVTWRGQIIPGSLFDFALYFFNNHKALLKKGSGPYFYLPKLQSHHEAK
WWSEVFHFTEEYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSY
IKTLKKHPDRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDPQENQ
KVLDKIQNDKSLEASNGHDGTWVAHPGLADTAMDVFNRALGERKNQLDVTRQDDAPITAK
QLLEPCDGARTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQ
HSKSLDNGEVVTKALFKRYLDEEIQVVKQEVGETRFDSGRFHEAAELMASLTTSDELTNF
LTVPGYDYLD
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaagaagaatgatgcttgctcaaacgcccgaaaaagaaaacacacaggctgaa
caacagacccaaggcatgcttgaagtaacaggaaccctgtctcctgaacatcaagctatt
ttccctgttgaagcccaaacctttttatctcagctgtgtgagcgattctcattgcgcgtc
gatcaattgttaactgcccgagaagagaggcagaacaagatcgatcaaggagagttacct
gattttcttacagagactcaggatattcgagaagggagctggaaaattttggggattccc
aacgatctgcaagatcgtcgagtcgaaattaccgggccaaccgatcgtaaaatggtgatc
aacgccctaaacgccaatgtaaaagtctttatggcggatttcgaagactcgatgtctcca
gcttgggataaggtgttggatggccagatcaacttgcgtgatgcggtcaatggcaccatc
tcctattccaaccccgataatggcaagcattatcagctgggcaacaatccagcggtgttg
atctgccgtgtccgcggtcttcatttaaaagaaaagcatgtgacgtggcgcggtcagatc
attccaggttccttatttgattttgctctttatttctttaataaccacaaagcgttgctg
aaaaaaggcagtggtccttatttctatcttcctaagttacagtctcatcatgaggcgaaa
tggtggagtgaagtgttccatttcaccgaagagtatttcggtttggatactggcactatc
aaagccacggtattgatcgagacgctgcctgccgtctttgaaatggatgagattctcttc
tcgttaaaagagcatattgttggcctcaactgtggccgttgggattacatttttagctat
atcaaaacactgaaaaagcacccagaccgtgtgctgcctgatcgtcaggtggtcaccatg
gacaagccgttcctcaatgcttactcgcgtttacttgtccgcacctgtcataaacgtggc
gcgtttgcgatgggagggatggccgcctttatcccagccaaagatccacaagagaatcaa
aaggtattggataagatccagaacgataaatcactcgaagccagtaatggccatgatggc
acttgggttgcgcatcctggtttagccgacaccgccatggacgtgtttaatcgtgctcta
ggtgagcgtaaaaaccagcttgatgtcactcgccaagacgatgcgccgattacagctaaa
cagttactggagccttgtgatggagcaagaacagaacaaggtatgagacacaatattcgt
gttgcattgcagtacatcgaggcgtggatctcggggaatggctgtgtaccgatttatggc
ttgatggaagatgcagcgaccgcagagatctcacgcgcttctatctggcagtggattcaa
catagtaagtcgttagataacggtgaagtggtgaccaaagcgttgtttaagcgttatctc
gacgaagagattcaagtcgtaaaacaagaagtgggggagactcgttttgattcaggccgt
ttccatgaagccgccgagttgatggctagcctgaccaccagtgatgagctaaccaacttc
ttaaccgtaccgggttatgactacctagattaa

DBGET integrated database retrieval system