KEGG   Vibrio vulnificus YJ016: VV0741Help
Entry
VV0741            CDS       T00150                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV0741
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV0741
   00630 Glyoxylate and dicarboxylate metabolism
    VV0741
Enzymes [BR:vvy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VV0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:746365..748017
Genome map
AA seq 550 aa AA seqDB search
MKGRRMMLAQTPEKENTQAEQQTQGMLEVTGTLSPEHQAIFPVEAQTFLSQLCERFSLRV
DQLLTAREERQNKIDQGELPDFLTETQDIREGSWKILGIPNDLQDRRVEITGPTDRKMVI
NALNANVKVFMADFEDSMSPAWDKVLDGQINLRDAVNGTISYSNPDNGKHYQLGNNPAVL
ICRVRGLHLKEKHVTWRGQIIPGSLFDFALYFFNNHKALLKKGSGPYFYLPKLQSHHEAK
WWSEVFHFTEEYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSY
IKTLKKHPDRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDPQENQ
KVLDKIQNDKSLEASNGHDGTWVAHPGLADTAMDVFNRALGERKNQLDVTRQDDAPITAK
QLLEPCDGARTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQ
HSKSLDNGEVVTKALFKRYLDEEIQVVKQEVGETRFDSGRFHEAAELMASLTTSDELTNF
LTVPGYDYLD
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaagaagaatgatgcttgctcaaacgcccgaaaaagaaaacacacaggctgaa
caacagacccaaggcatgcttgaagtaacaggaaccctgtctcctgaacatcaagctatt
ttccctgttgaagcccaaacctttttatctcagctgtgtgagcgattctcattgcgcgtc
gatcaattgttaactgcccgagaagagaggcagaacaagatcgatcaaggagagttacct
gattttcttacagagactcaggatattcgagaagggagctggaaaattttggggattccc
aacgatctgcaagatcgtcgagtcgaaattaccgggccaaccgatcgtaaaatggtgatc
aacgccctaaacgccaatgtaaaagtctttatggcggatttcgaagactcgatgtctcca
gcttgggataaggtgttggatggccagatcaacttgcgtgatgcggtcaatggcaccatc
tcctattccaaccccgataatggcaagcattatcagctgggcaacaatccagcggtgttg
atctgccgtgtccgcggtcttcatttaaaagaaaagcatgtgacgtggcgcggtcagatc
attccaggttccttatttgattttgctctttatttctttaataaccacaaagcgttgctg
aaaaaaggcagtggtccttatttctatcttcctaagttacagtctcatcatgaggcgaaa
tggtggagtgaagtgttccatttcaccgaagagtatttcggtttggatactggcactatc
aaagccacggtattgatcgagacgctgcctgccgtctttgaaatggatgagattctcttc
tcgttaaaagagcatattgttggcctcaactgtggccgttgggattacatttttagctat
atcaaaacactgaaaaagcacccagaccgtgtgctgcctgatcgtcaggtggtcaccatg
gacaagccgttcctcaatgcttactcgcgtttacttgtccgcacctgtcataaacgtggc
gcgtttgcgatgggagggatggccgcctttatcccagccaaagatccacaagagaatcaa
aaggtattggataagatccagaacgataaatcactcgaagccagtaatggccatgatggc
acttgggttgcgcatcctggtttagccgacaccgccatggacgtgtttaatcgtgctcta
ggtgagcgtaaaaaccagcttgatgtcactcgccaagacgatgcgccgattacagctaaa
cagttactggagccttgtgatggagcaagaacagaacaaggtatgagacacaatattcgt
gttgcattgcagtacatcgaggcgtggatctcggggaatggctgtgtaccgatttatggc
ttgatggaagatgcagcgaccgcagagatctcacgcgcttctatctggcagtggattcaa
catagtaagtcgttagataacggtgaagtggtgaccaaagcgttgtttaagcgttatctc
gacgaagagattcaagtcgtaaaacaagaagtgggggagactcgttttgattcaggccgt
ttccatgaagccgccgagttgatggctagcctgaccaccagtgatgagctaaccaacttc
ttaaccgtaccgggttatgactacctagattaa

DBGET integrated database retrieval system