KEGG   Vibrio vulnificus YJ016: VV0742Help
Entry
VV0742            CDS       T00150                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV0742
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VV0742
Enzymes [BR:vvy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VV0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:748085..749458
Genome map
AA seq 457 aa AA seqDB search
MEYIAHSILIISAHQKKDRPMTNLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVALRG
SMVPANTIAQRGADKLWSLVNGSSKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAA
DNNTASTMYPDQSLYPVDSVPSVVKRINNSFRRADQIQWSNGKSPEEGGIDYFLPIVADA
EAGFGGVLNAYELMKSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARL
AADVAGTTTLVIARTDANAADLLTSDCDPYDADFIVGERTQEGFYRVRAGIDQAISRGLA
YAPYADLIWCETATPCLEEARKFAEAIHAEYPDQLLAYNCSPSFNWEKNLDAETIAKFQQ
ELADMGYKYQFITLAGIHNMWFNMFELAHAYAQGEGMRHYVEKVQRPEFEAAEKGYTFVA
HQQEVGTGYFDKMTNTIQGGNSSVTALTGSTEEDQFH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaatatatagcgcactcaattttaataatcagcgctcatcaaaagaaggatagaccg
atgacaaacttaactcgccgccagcaaatcgaagctctggaaaaagattgggcaaccaat
cctcgttggaaaaacgtcaaacgcacttacacagctgaggaagtggtggccttacgtggc
tctatggtgccagctaataccatcgcgcagcgtggtgccgacaagttgtggtcgttggtg
aatggtagctcgaaaaaaggctatgtgaattgtctaggcgcactaactggtggccaagcg
gtgcagcaagccaaagcggggatagaagcgatctacctatcgggttggcaggttgcagcg
gataacaacaccgcctcgaccatgtacccagaccaatcactttaccctgtggattcggtt
ccttcagtagtcaaacgcattaacaattcgttccgccgcgcagaccaaattcaatggtcg
aatggtaagtcgccagaagagggtggaattgattacttcttgcctatcgttgctgatgca
gaagcgggctttggtggtgtgctgaatgcgtatgagctgatgaagtcgatgattgaagca
ggggccgcgggtgtacactttgaagaccaattggcttcggtgaagaagtgtggccatatg
ggcggtaaagtattggttccaacgcaagaagcggtgcaaaaactggttgctgcgcgtcta
gccgcagatgttgctggtacaacgacattggtgattgctcgaactgatgccaatgcggcg
gatttgttgacgtcagattgtgacccatatgacgcagactttattgttggcgagcgcact
caggaaggtttctatcgtgttcgtgcagggattgaccaagcgatctcacgtggccttgct
tatgcgccatatgcggatcttatttggtgtgaaacggcaactccgtgtcttgaagaagcg
cgtaagtttgctgaggctattcatgcggaatacccagaccaactgttggcatacaactgc
tcgccatcatttaactgggagaaaaacctggatgctgagaccattgctaagttccaacaa
gaactcgcagatatgggttacaagtaccagttcatcaccctagctggtattcacaacatg
tggttcaacatgtttgaactggcacacgcatatgctcaaggtgaaggtatgcgtcactac
gttgagaaagttcagcgtcctgaatttgaagcggcggaaaaaggctacaccttcgttgca
caccaacaagaagtgggtacgggttactttgataagatgaccaacaccatccaaggtggt
aactcttcagtcacggcactgacgggctctaccgaagaagaccagttccattaa

DBGET integrated database retrieval system