KEGG   Vibrio vulnificus YJ016: VV0742Help
Entry
VV0742            CDS       T00150                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00630  Glyoxylate and dicarboxylate metabolism
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy01200  Carbon metabolism
Module
vvy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VV0742
Enzymes [BR:vvy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VV0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAC93506
UniProt: Q7MNH5
Position
I:748085..749458
Genome map
AA seq 457 aa AA seqDB search
MEYIAHSILIISAHQKKDRPMTNLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVALRG
SMVPANTIAQRGADKLWSLVNGSSKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAA
DNNTASTMYPDQSLYPVDSVPSVVKRINNSFRRADQIQWSNGKSPEEGGIDYFLPIVADA
EAGFGGVLNAYELMKSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARL
AADVAGTTTLVIARTDANAADLLTSDCDPYDADFIVGERTQEGFYRVRAGIDQAISRGLA
YAPYADLIWCETATPCLEEARKFAEAIHAEYPDQLLAYNCSPSFNWEKNLDAETIAKFQQ
ELADMGYKYQFITLAGIHNMWFNMFELAHAYAQGEGMRHYVEKVQRPEFEAAEKGYTFVA
HQQEVGTGYFDKMTNTIQGGNSSVTALTGSTEEDQFH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaatatatagcgcactcaattttaataatcagcgctcatcaaaagaaggatagaccg
atgacaaacttaactcgccgccagcaaatcgaagctctggaaaaagattgggcaaccaat
cctcgttggaaaaacgtcaaacgcacttacacagctgaggaagtggtggccttacgtggc
tctatggtgccagctaataccatcgcgcagcgtggtgccgacaagttgtggtcgttggtg
aatggtagctcgaaaaaaggctatgtgaattgtctaggcgcactaactggtggccaagcg
gtgcagcaagccaaagcggggatagaagcgatctacctatcgggttggcaggttgcagcg
gataacaacaccgcctcgaccatgtacccagaccaatcactttaccctgtggattcggtt
ccttcagtagtcaaacgcattaacaattcgttccgccgcgcagaccaaattcaatggtcg
aatggtaagtcgccagaagagggtggaattgattacttcttgcctatcgttgctgatgca
gaagcgggctttggtggtgtgctgaatgcgtatgagctgatgaagtcgatgattgaagca
ggggccgcgggtgtacactttgaagaccaattggcttcggtgaagaagtgtggccatatg
ggcggtaaagtattggttccaacgcaagaagcggtgcaaaaactggttgctgcgcgtcta
gccgcagatgttgctggtacaacgacattggtgattgctcgaactgatgccaatgcggcg
gatttgttgacgtcagattgtgacccatatgacgcagactttattgttggcgagcgcact
caggaaggtttctatcgtgttcgtgcagggattgaccaagcgatctcacgtggccttgct
tatgcgccatatgcggatcttatttggtgtgaaacggcaactccgtgtcttgaagaagcg
cgtaagtttgctgaggctattcatgcggaatacccagaccaactgttggcatacaactgc
tcgccatcatttaactgggagaaaaacctggatgctgagaccattgctaagttccaacaa
gaactcgcagatatgggttacaagtaccagttcatcaccctagctggtattcacaacatg
tggttcaacatgtttgaactggcacacgcatatgctcaaggtgaaggtatgcgtcactac
gttgagaaagttcagcgtcctgaatttgaagcggcggaaaaaggctacaccttcgttgca
caccaacaagaagtgggtacgggttactttgataagatgaccaacaccatccaaggtggt
aactcttcagtcacggcactgacgggctctaccgaagaagaccagttccattaa

DBGET integrated database retrieval system