KEGG   Vibrio vulnificus YJ016: VV0858Help
Entry
VV0858            CDS       T00150                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VV0858
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VV0858
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VV0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:863123..864262
Genome map
AA seq 379 aa AA seqDB search
MTTNQQSVAASQPKTIVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSVVVVSSG
AIAAGREHLGYPALPNAMASKQLLAAVGQSQLIQTWESLFALYGIKIGQMLLTRADLEDR
ERFLNARDTINALVDNGIIPVVNENDAVATSEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLYTADPRKDPNAELIKEVKVIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGRGQNVIFDALSPAPQGTRFLPCEEALENRKRWILAGPAASGDIVIDQGAVKAVVE
KGSSLLAKGVTKVLGEFSRGEVVRVTDAQGHLVARGIASYSNQDMAKIAGKHSKDIISIL
GYDYGSEVIHRDDMVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacaaagcgtcgctgcttctcaaccaaaaactatcgttgtgaagctt
ggaaccagtgtgttaacaggtggtacattagcgttagatcgcgctcatatggttgagctt
gcgcgccaatgtgcagagttaaaaaaacaaggccactctgtggtggtcgtctcgtcaggc
gcgattgccgctggacgtgagcacttaggttaccccgcgctgcccaatgcgatggcaagc
aaacagttgcttgctgcggttgggcaaagtcagttgattcaaacctgggaatcgttattt
gcactgtatggcatcaaaattggccaaatgttgctcactcgagcggatctcgaagatcgc
gaacgttttctcaatgctcgagatacgattaacgcgttagtggataacggcattatccct
gtcgttaatgaaaatgacgccgtcgccacgagcgaaatcaaagtgggtgacaacgacaac
ctctctgcgttggtgggcattttatgtggtgctgataaactactgttgctgacagaccaa
aaaggcttgtataccgccgatccgcgtaaagatcccaatgctgagctgatcaaagaagtt
aaagtcattgacgatactttgcgtaaaattgctggtggcagcggtacaacattaggtact
ggtgggatggcaacaaagctccaagctgcggacattgcgcgtcgtgctggcattgaagtc
atcattgcggcaggccgtggtcaaaatgtcatttttgatgcgttgagcccagcccctcaa
ggaacccgtttcttgccttgtgaagaggcgttggaaaaccgcaagcgttggattctcgct
ggccctgcggcctctggtgatattgtgattgaccaaggtgcggtgaaagccgtggtcgaa
aaagggagcagtttgttggcgaaaggggtgaccaaagtacttggcgagttttctcgtggc
gaagtagttcgtgtaacggatgcacagggccatttggttgcgcgaggtattgcgagttat
tccaaccaagatatggcgaaaattgccggtaagcacagcaaagacattatttcgattctg
ggctatgactatggttcagaagtgattcaccgtgacgacatggttgtcattcaagaatag

DBGET integrated database retrieval system