KEGG   Vibrio vulnificus YJ016: VV1029Help
Entry
VV1029            CDS       T00150                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV1029
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VV1029
   00650 Butanoate metabolism
    VV1029
  Energy metabolism
   00190 Oxidative phosphorylation
    VV1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1027394..1027738
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSVGRNGVHDFLLIRATAIIMTLYTIYLVSFCAFTDINYASWTQFFGGTFTKVFT
MLALASVLIHAWIGLWQVLTDYIKCAKLRGGLQLGVIALLFGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtttcctctgttggccgtaacggtgtgcatgatttcttgttgattcgt
gcaacggccatcatcatgactctttacaccatttatcttgttagcttctgtgcgttcaca
gatatcaattatgcatcctggactcagttttttggtggcacttttactaaagtcttcacc
atgcttgctctcgcttctgtcctgattcatgcctggattggattatggcaagtgctgact
gactacatcaagtgcgccaaattgcgtggtggtttacaacttggtgtgatcgcactgctt
ttcgggtatttcttctctggtctgtttgtattgtggggtgcataa

DBGET integrated database retrieval system