KEGG   Vibrio vulnificus YJ016: VV1029Help
Entry
VV1029            CDS       T00150                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00020  Citrate cycle (TCA cycle)
vvy00190  Oxidative phosphorylation
vvy00650  Butanoate metabolism
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy01130  Biosynthesis of antibiotics
vvy01200  Carbon metabolism
Module
vvy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vvy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vvy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VV1029
   00650 Butanoate metabolism
    VV1029
  Energy metabolism
   00190 Oxidative phosphorylation
    VV1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAC93793
UniProt: Q7MMN8
Position
I:1027394..1027738
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSVGRNGVHDFLLIRATAIIMTLYTIYLVSFCAFTDINYASWTQFFGGTFTKVFT
MLALASVLIHAWIGLWQVLTDYIKCAKLRGGLQLGVIALLFGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtttcctctgttggccgtaacggtgtgcatgatttcttgttgattcgt
gcaacggccatcatcatgactctttacaccatttatcttgttagcttctgtgcgttcaca
gatatcaattatgcatcctggactcagttttttggtggcacttttactaaagtcttcacc
atgcttgctctcgcttctgtcctgattcatgcctggattggattatggcaagtgctgact
gactacatcaagtgcgccaaattgcgtggtggtttacaacttggtgtgatcgcactgctt
ttcgggtatttcttctctggtctgtttgtattgtggggtgcataa

DBGET integrated database retrieval system