KEGG   Vibrio vulnificus YJ016: VV1033Help
Entry
VV1033            CDS       T00150                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV1033
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VV1033
  Amino acid metabolism
   00310 Lysine degradation
    VV1033
Enzymes [BR:vvy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VV1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1033185..1034393
Genome map
AA seq 402 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGDRVERDEVLVDIETDKVVLEVPASEAGILEAIV
EEEGATVLSKQLIGRIKLAAVAGEPTADTTEESEPSPDKRHTASLSEESNDALSPAVRRL
LAEHSLEASQVKGTGVGGRITREDIEAHLAAAKQAPAVAEAPAAVAPVAARSEKRVPMTR
LRKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDQFEARHGIRLGFMSFYVKAVT
EALKRYPEINASIDGDDIVYHNYFDISMAVSTPRGLVTPVLKDCDTLGFADVEKGIKELA
IKGRDGKLTVDELIGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPARLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattctggttccagatttacctgaatcagtggccgatgcaacagttgca
acttggcacaagaaaccaggcgacagagttgagcgcgatgaagtactggttgatattgaa
acagacaaagtagtgttagaagtaccggcttcagaagcgggtattctagaagcgatcgtt
gaagaagaaggtgcgacagtgctttcgaagcaactgattggtcgcattaaattggcggct
gtcgcgggtgaacctacggctgatacaacggaagagtcagagccatctccagataagcgt
catacagcaagcttatcagaagagagcaatgatgcccttagtccagcggtgcgtcgcctt
ctcgcagaacatagcttggaagcaagccaagtaaaaggtacgggtgttggtggccgtatt
acacgtgaagatatcgaagcgcaccttgccgcggcaaaacaagctcctgcagttgcagaa
gctcctgctgcagttgcaccggttgctgctcgcagtgaaaaacgtgttccaatgacacgt
ctacgcaaaacagtggctaaccgtttgctagaagcgaaaaacagcacggcgatgttgacg
acgtttaacgaagttaacatgaagccaatcatggatcttcgtaagcagtatggtgatcag
tttgaagcgcgtcatggtattcgtcttggcttcatgtctttctacgtgaaagcggtgact
gaagcactgaagcgttatcctgaaatcaacgcatcgatcgatggtgatgacattgtttac
cacaactattttgacatcagtatggcggtttctacgccacgtggtctagtgactccagtc
ctaaaagactgcgacacgctaggttttgcggatgttgaaaagggtatcaaagagctcgcc
atcaaaggtcgtgacggaaaactaaccgttgatgagctaattggcggcaactttaccatc
acgaatggtggtgtgtttggttcattgatgtcgactccaatcatcaacccaccacaatct
gcgattttgggtatgcataagattcaagatcgtccgatggcggtagatggcaaagttgaa
attctgccaatgatgtacctagcactgtcttatgaccaccgcttgattgatggtcgcgag
tcggttggcttcctagtgaccgtgaaagagttactggaagatccagcacgtctgttgtta
gacgtttaa

DBGET integrated database retrieval system