KEGG   Vibrio vulnificus YJ016: VV1067Help
Entry
VV1067            CDS       T00150                                 

Definition
(GenBank) putative beta-ketoacyl-ACP reductase
  KO
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VV1067
  Lipid metabolism
   00061 Fatty acid biosynthesis
    VV1067
   01040 Biosynthesis of unsaturated fatty acids
    VV1067
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VV1067
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     VV1067
Lipid biosynthesis proteins [BR:vvy01004]
 Fatty acid synthase
  Component type
   VV1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1069038..1069829)
Genome map
AA seq 263 aa AA seqDB search
MSVERLCSNGRKITRNENQESRMTRQVLVTGASKGIGKAIAIQLAKDGFTIVVHYMGDKQ
GAEQTLAMIEQNGGSGRLIQFDISHRQQCRERIEADIAEHGAYYGVVNNAGITKDTAFPA
MTEAEWDGVIHTNLDSFYNVLHPCVMPMVQKRKGGRIVTLASVSGLMGNRGQTNYAAAKA
GVIGATKSLALELAKRKITVNCVAPGLIDTGMVDEHVKEHALPQVPLRRMGEPEEVAGLV
SYLMSDIAGYVTRQVISVNGGLI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgaacgtttatgttccaacggaagaaaaattacaagaaatgaaaatcaggag
tcaagaatgacccgtcaagtgttagtcacaggggccagtaaaggcatcggcaaagccatc
gccattcaattagcgaaagatggctttaccatcgtcgttcactacatgggcgataagcaa
ggtgccgagcaaacattggccatgattgaacaaaacggtggcagtggccgtttaattcag
tttgatattagccatcgtcaacaatgtcgtgagcgtattgaagccgacatcgcagagcac
ggcgcatactacggagtggtcaataacgcgggtatcaccaaagacaccgctttcccagcg
atgaccgaagcagaatgggatggcgtaattcacaccaacctcgacagtttttataacgtc
ttacacccttgcgtgatgccgatggtgcaaaaacgcaaaggtggacgcattgttactttg
gcctccgtctccggattaatgggcaatcgaggtcaaaccaactacgccgctgccaaagcg
ggggtgattggcgcaaccaaatcattggctctcgagctggcgaaacgcaaaatcaccgtg
aactgtgtcgcccctgggctgattgatacaggcatggtggatgagcatgtcaaagagcac
gctttacctcaagtaccgctacgccgcatgggtgagccagaagaagtggctggcttagtc
agttatttgatgtctgacatcgcaggttatgtcactcgccaagtgatttcggttaatgga
ggcctaatatga

DBGET integrated database retrieval system