KEGG   Vibrio vulnificus YJ016: VV1067Help
Entry
VV1067            CDS       T00150                                 

Gene name
fabG
Definition
3-ketoacyl-ACP reductase (EC:1.1.1.100)
Orthology
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VV1067 (fabG)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    VV1067 (fabG)
   01040 Biosynthesis of unsaturated fatty acids
    VV1067 (fabG)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VV1067 (fabG)
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     VV1067 (fabG)
Lipid biosynthesis proteins [BR:vvy01004]
 Fatty acid synthase
  Component type
   VV1067 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1069038..1069763)
Genome map
AA seq 241 aa AA seqDB search
MTRQVLVTGASKGIGKAIAIQLAKDGFTIVVHYMGDKQGAEQTLAMIEQNGGSGRLIQFD
ISHRQQCRERIEADIAEHGAYYGVVNNAGITKDTAFPAMTEAEWDGVIHTNLDSFYNVLH
PCVMPMVQKRKGGRIVTLASVSGLMGNRGQTNYAAAKAGVIGATKSLALELAKRKITVNC
VAPGLIDTGMVDEHVKEHALPQVPLRRMGEPEEVAGLVSYLMSDIAGYVTRQVISVNGGL
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcaagtgttagtcacaggggccagtaaaggcatcggcaaagccatcgccatt
caattagcgaaagatggctttaccatcgtcgttcactacatgggcgataagcaaggtgcc
gagcaaacattggccatgattgaacaaaacggtggcagtggccgtttaattcagtttgat
attagccatcgtcaacaatgtcgtgagcgtattgaagccgacatcgcagagcacggcgca
tactacggagtggtcaataacgcgggtatcaccaaagacaccgctttcccagcgatgacc
gaagcagaatgggatggcgtaattcacaccaacctcgacagtttttataacgtcttacac
ccttgcgtgatgccgatggtgcaaaaacgcaaaggtggacgcattgttactttggcctcc
gtctccggattaatgggcaatcgaggtcaaaccaactacgccgctgccaaagcgggggtg
attggcgcaaccaaatcattggctctcgagctggcgaaacgcaaaatcaccgtgaactgt
gtcgcccctgggctgattgatacaggcatggtggatgagcatgtcaaagagcacgcttta
cctcaagtaccgctacgccgcatgggtgagccagaagaagtggctggcttagtcagttat
ttgatgtctgacatcgcaggttatgtcactcgccaagtgatttcggttaatggaggccta
atatga

DBGET integrated database retrieval system