KEGG   Vibrio vulnificus YJ016: VV1146Help
Entry
VV1146            CDS       T00150                                 

Definition
aldose 1-epimerase-related protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1146
Enzymes [BR:vvy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VV1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1157785..1158696)
Genome map
AA seq 303 aa AA seqDB search
MKLIVKEIQMDLNSLPALTVLSDCVTIVEKDNVKIVRVIHEKATAGISLFGGHVVSYQPT
GKADVIWMSDKAVFDGKTALRGGIPVCWPWFGRIAAPAHGFARTSEWELVEHRENDNGVI
VELALFPTEESHNLWPHMFDVRLIVEIGDELKVSLNILNIDDDAFTFSGALHTYLNVGDI
EQTQTMGMGSEYIDSLKAGELCNGGEVLQLTDTIDRVYTQPEKEIVVKDPVIERTLCIEN
QGHNCAVLWNPWAQGAAGMADMSDDGYKTMLCVESTLHADSITQGKTLNPGESHQLITVL
SAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgattgttaaggaaattcagatggatcttaattcacttccggcgctgactgtc
ctgtctgattgcgtcaccattgttgaaaaagacaatgtcaaaattgttcgtgtgattcac
gagaaagcaaccgcaggtatctctttgtttggcggccatgttgtctcctatcagccgacg
ggtaaagctgacgtcatttggatgagtgacaaggcagtatttgatggtaaaactgcgctg
cgcggcggcattccggtttgttggccttggtttggccgcattgcagcacctgcacacggc
tttgctcgcacttcagagtgggaactggttgaacaccgcgaaaacgacaacggtgtgatc
gtggaactcgccttgttcccgacagaagaatcgcacaatctctggcctcatatgtttgat
gttcgcctaatcgtcgagatcggcgatgaactgaaagtgtcactcaacattcttaatatt
gatgacgacgcattcactttctcgggcgctctgcatacctatttgaacgtcggtgatatt
gaacaaactcaaactatgggcatgggctctgagtacattgacagtttgaaagcgggcgaa
ctatgcaatggcggtgaagttttacaattgaccgacacgatcgatcgtgtctacacacaa
cctgagaaagagattgtggttaaagacccagtcattgaacgtactctgtgcattgaaaac
caaggtcacaactgcgccgtgctctggaacccttgggctcaaggtgccgctggcatggcg
gacatgagcgatgacggttacaaaaccatgctgtgtgtagaatccactctgcatgcagac
agtattactcagggcaaaacgctcaaccctggcgaaagtcaccagttaatcactgtgctt
tctgcgcgctaa

DBGET integrated database retrieval system