KEGG   Vibrio vulnificus YJ016: VV1146Help
Entry
VV1146            CDS       T00150                                 

Definition
(GenBank) aldose 1-epimerase-related protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00010  Glycolysis / Gluconeogenesis
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1146
Enzymes [BR:vvy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VV1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF4352 DUF4766
Motif
Other DBs
NCBI-ProteinID: BAC93910
UniProt: Q7MMC6
Position
I:complement(1157785..1158696)
Genome map
AA seq 303 aa AA seqDB search
MKLIVKEIQMDLNSLPALTVLSDCVTIVEKDNVKIVRVIHEKATAGISLFGGHVVSYQPT
GKADVIWMSDKAVFDGKTALRGGIPVCWPWFGRIAAPAHGFARTSEWELVEHRENDNGVI
VELALFPTEESHNLWPHMFDVRLIVEIGDELKVSLNILNIDDDAFTFSGALHTYLNVGDI
EQTQTMGMGSEYIDSLKAGELCNGGEVLQLTDTIDRVYTQPEKEIVVKDPVIERTLCIEN
QGHNCAVLWNPWAQGAAGMADMSDDGYKTMLCVESTLHADSITQGKTLNPGESHQLITVL
SAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgattgttaaggaaattcagatggatcttaattcacttccggcgctgactgtc
ctgtctgattgcgtcaccattgttgaaaaagacaatgtcaaaattgttcgtgtgattcac
gagaaagcaaccgcaggtatctctttgtttggcggccatgttgtctcctatcagccgacg
ggtaaagctgacgtcatttggatgagtgacaaggcagtatttgatggtaaaactgcgctg
cgcggcggcattccggtttgttggccttggtttggccgcattgcagcacctgcacacggc
tttgctcgcacttcagagtgggaactggttgaacaccgcgaaaacgacaacggtgtgatc
gtggaactcgccttgttcccgacagaagaatcgcacaatctctggcctcatatgtttgat
gttcgcctaatcgtcgagatcggcgatgaactgaaagtgtcactcaacattcttaatatt
gatgacgacgcattcactttctcgggcgctctgcatacctatttgaacgtcggtgatatt
gaacaaactcaaactatgggcatgggctctgagtacattgacagtttgaaagcgggcgaa
ctatgcaatggcggtgaagttttacaattgaccgacacgatcgatcgtgtctacacacaa
cctgagaaagagattgtggttaaagacccagtcattgaacgtactctgtgcattgaaaac
caaggtcacaactgcgccgtgctctggaacccttgggctcaaggtgccgctggcatggcg
gacatgagcgatgacggttacaaaaccatgctgtgtgtagaatccactctgcatgcagac
agtattactcagggcaaaacgctcaaccctggcgaaagtcaccagttaatcactgtgctt
tctgcgcgctaa

DBGET integrated database retrieval system