KEGG   Vibrio vulnificus YJ016: VV1216Help
Entry
VV1216            CDS       T00150                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VV1216
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VV1216
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VV1216
Enzymes [BR:vvy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VV1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1228879..1229685)
Genome map
AA seq 268 aa AA seqDB search
MDRYQATFERLAAQKQGAFVPFVTVCDPNPELSLKIMDTLVQAGADALELGIPFSDPLAD
GPTIQGANIRALDSGATPDICFDLIGQIRAKYPDLPIGLLMYANLVYSRGIENFYQRCAQ
AGIDSVLIADVPTNESAEFVAAAEKFGVHPIFIAPPTASDETLKQVSQLGGGYTYLLSRA
GVTGAETKANMPVGDMLAKLEQFNAPPALLGFGISEPEQVKQAIDAGAAGAISGSAVVKI
IESHLNEPDAMLTALANFVSSMKSATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttatcaagcgacatttgagcgcctcgccgcgcaaaaacaaggtgcctttgtt
ccttttgttaccgtgtgtgaccctaaccctgaactctcactcaagatcatggatacctta
gttcaagcgggtgccgatgctcttgaacttggcattccattttctgatccattggccgac
ggcccaacgatccaaggcgcaaatattcgcgcgctggattcaggcgcaacacctgatatc
tgttttgatttgatcggacaaatccgagctaaatacccagatctaccgattggcctgttg
atgtacgccaacttggtctattcacgtggtatcgagaatttctaccaacgttgcgctcaa
gcaggcattgattctgtgttgatcgccgatgtcccaacgaacgagagtgcagagtttgtc
gcggcagccgaaaagtttggtgtacatccaatctttatcgcaccaccaacggccagtgat
gaaacactaaaacaggtttcacaactgggtggcggttatacctatcttctctctcgagcg
ggggtcacaggagctgaaacaaaagccaacatgcctgtgggtgatatgcttgcgaagcta
gaacaatttaatgcgccacctgcactgttgggctttggtatatcagagcctgaacaagtc
aaacaggctatcgatgcgggtgcggcaggtgccatttcaggctctgcagtggtcaaaatc
atcgaaagtcacctcaatgaacctgacgcgatgttaacggcactggcaaactttgtttcc
agcatgaagtctgcaacacaaaagtaa

DBGET integrated database retrieval system