KEGG   Vibrio vulnificus YJ016: VV1218Help
Entry
VV1218            CDS       T00150                                 

Gene name
trpC, trpF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VV1218 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VV1218 (trpC)
Enzymes [BR:vvy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VV1218 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VV1218 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1230951..1232381)
Genome map
AA seq 476 aa AA seqDB search
MMTNSNEKLSEHVSLQEAQMAEVLAKIVRDKYQWVAERKHAQPLASFQATLTPSDRSFYQ
ALQGQRTVFITECKKASPSKGLIREDFDLDYIASVYNHHADAISVLTDEKYFQGSFDFLP
RVRQQVRQPVLCKDFMVDSYQVYLARHYQADAILLMLSVLNDEQYQTLADVAHQLQMGVL
TEISNDEELERAVKLGAKVIGINNRNLRDLTTDLNRTKVLAPTLRRLAPEAIVISESGIY
THQQVRDLAQYADGFLIGSSLMAEKNLELAVRKVTLGENKVCGLTHPEEAAKAYQAGAVF
GGLIFVEHSKRAVNIEQARLTMSGAPLNYVGVFQNHPVTLVAETANQLQLHAVQLHGNEE
ADYIAQLRKQLNESIEIWKAYGVTDQAPTLLTQDVDRHLFDAQVGQQSGGTGTTFDWALL
DDPSHIMLAGGLNPDNAQKAASLGCLGLDLNSGVEESPGKKDLTKLQQAFAAIRNY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaacagcaacgaaaaactgtcagaacacgtttctctgcaggaagcacaaatg
gcggaagtcctagccaagatagtgcgcgataaataccagtgggtagccgagcgtaaacac
gcgcaaccattggccagttttcaagccacattgacaccatcggatcgcagcttttaccaa
gccttgcagggccaacgcacggtattcattaccgaatgtaagaaagcctccccatcgaag
ggattgatccgtgaagatttcgacttggattacatcgcgtcggtgtacaaccaccacgca
gatgcgatttcggtactcaccgatgagaaatacttccaaggcagcttcgactttctgccc
cgagtgcgtcagcaagtgcgccagcctgtgttgtgtaaagattttatggtcgatagctat
caagtttatctcgctcgtcactatcaagccgacgccattttattgatgttgtcagtcctc
aatgacgagcaatatcaaacactggcggatgttgcccaccagttgcaaatgggtgtgctg
acagaaatcagtaatgacgaagagcttgagcgtgctgtgaagctgggggcgaaagtgatc
ggtattaacaaccgcaacttacgagacctcaccaccgatttgaatcgcaccaaagtactc
gcaccaactttgcgtcgcttagcaccagaagcgattgtgatctcggaatcgggcatttac
acccaccagcaagtgcgcgatctcgcccaatacgctgatggctttttgatcggtagctcg
ttgatggcagaaaaaaacctcgagctcgcggtacgtaaagtgacactgggtgaaaacaaa
gtctgtggtctcactcatccggaggaagccgccaaagcctatcaagctggcgctgtcttt
ggtggtttgatttttgtagagcactccaaacgtgctgtaaatatagagcaggcaagactg
acgatgagtggcgctccactcaattatgttggcgtattccaaaatcaccccgttaccttg
gtggccgaaaccgcaaaccagctgcaactgcatgcggtgcaattacatggcaacgaagaa
gccgattacatcgcacaactgcgcaagcaactcaacgaatcgattgagatttggaaagcc
tatggcgtgaccgaccaagcaccgactctacttactcaagatgttgatcgtcaccttttc
gatgcgcaagtcggccaacaaagcggtggaacagggaccacgtttgattgggctctattg
gatgatccaagccatatcatgttggcaggcggtctcaatccagacaacgcgcaaaaggca
gcaagccttggatgtttagggctggatttaaactctggtgttgaagaaagcccagggaaa
aaagatctaacgaagctgcagcaagcgtttgcagccatacgaaattattga

DBGET integrated database retrieval system