KEGG   Vibrio vulnificus YJ016: VV1379Help
Entry
VV1379            CDS       T00150                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VV1379
  Lipid metabolism
   00561 Glycerolipid metabolism
    VV1379
   00600 Sphingolipid metabolism
    VV1379
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VV1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1404041..1405783
Genome map
AA seq 580 aa AA seqDB search
MMESPYTLGNHIPFEVNDDEVEVTINNNEVHFCYHGMHNRIIDDRFELFRTPFNFEAQAQ
LLGDGFQMLAQTTGTRDQVIDIGRCPDNNPQYRLYSQHAPKRYYNYLVIEESQGYTLFGF
TSCRRFAGYFELEQAGNHWHVVAYLDGEQTEIQDWETNTLESVVLLEGASLSELYAEFAQ
HITVHHPIRAGVEQNSPVGWCSWYAYYADVSQQNILENVEQMQGSLEALEWVLLDDGYQA
FMGDWLTPSDKFSGGVKQLIAQIRASGKKPAIWLAPFIAQPESEIFRKHPEWFVKHQDGS
LLKAEDITYGGWRCTPWYILDTSHPEVQEHLTHVVKTMREEWGVELFKLDANYWGTLKGQ
RYQKGITGVEAYRLGMDAIAQGAGEAWLLGCNAPMWPSLGLVDAMRVSDDVERHAHRFEQ
IAKETFYRSWQHRKLWQIDPDCATFTSLPNQGAQRQEYEFHRNVLLACGGLLLSGDPLPE
ITPFAKSCLAKLMVRQKHNQNAAKFTAFSLNHAFLKLTEKNDLHCLFNYDGQQDKEFTLI
SDTPVHWYDYWTQERLSDEPCQLFVTQLNPGLNAKAIVTA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
ttgatggaaagcccttataccttaggcaatcacattcctttcgaggtgaatgatgatgaa
gtggaagtgacgataaataacaatgaagttcacttctgctatcacggtatgcacaaccgt
atcatcgatgatcgatttgaactttttcgtactcctttcaattttgaagctcaggctcag
ctcttgggggacgggtttcaaatgttggcgcagaccacaggcactcgagaccaagtgatc
gacatcggtcgttgtcctgacaataatccacaatatcgcctttattcacagcatgcgcct
aagcgttactacaactacttagtgattgaggaatcacagggttacaccttgtttggtttt
acctcatgtcggcgcttcgctggctattttgagctggaacaggcgggtaaccactggcat
gttgtcgcttatcttgatggcgaacagacggaaatccaagattgggaaaccaatacgctg
gaatctgtagtgctgttggaaggagcgtctttgtctgagctctatgctgagtttgcgcaa
catattacggttcatcatccgatcagagcaggggtggagcagaattcgccagtaggttgg
tgttcttggtatgcctattatgccgatgtgagccagcaaaatatcttagagaatgtcgaa
cagatgcagggcagcttagaggcgctggagtgggtcttacttgatgatggctatcaggcc
tttatgggcgattggcttactccttctgacaagttttcagggggagtcaaacaactgatt
gcacaaattcgagcgagtggcaaaaaaccagcgatttggctggcgccctttattgctcag
cctgaatcagagatctttcgtaagcatcccgaatggtttgttaaacatcaggatggctca
ctgctaaaagcagaggacatcacttatggcggttggcgctgtacaccttggtatatcctt
gacacatcacatcctgaagtgcaggagcacctaactcatgtagtaaaaaccatgcgagaa
gagtggggtgtagagctctttaaattggacgctaactattgggggacgctaaaagggcag
cgttaccaaaaaggcataacaggtgttgaagcgtatcgactcgggatggatgcgatcgct
caaggagcgggcgaagcgtggctacttggttgtaacgcgccaatgtggccttctttagga
ttggttgatgccatgcgcgtttcggatgacgttgagcgccacgcacatcgctttgaacaa
attgccaaagagaccttctaccgcagttggcagcatcgaaaactgtggcagattgatcct
gactgcgcaacgttcacttcgctacctaaccaaggcgcgcaaaggcaagaatatgaattt
caccgcaatgtcctacttgcgtgtggcgggctgcttctgtcgggtgatccacttccagag
atcacgccattcgccaaatcttgtcttgccaaattgatggttcgtcaaaagcacaatcag
aatgcggcgaagtttaccgcgttcagtctcaaccacgccttcttgaagctaaccgagaaa
aacgatctgcactgtttgttcaattatgacggccagcaagacaaagagtttacgttgatc
tctgatacgccagtgcattggtacgactactggacacaagaacgcttaagtgatgagcct
tgccagttgtttgtgacccaattaaatccgggcttgaatgccaaagccatcgtcacagcg
taa

DBGET integrated database retrieval system