KEGG   Vibrio vulnificus YJ016: VV1466Help
Entry
VV1466            CDS       T00150                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:vvy00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:vvy00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:vvy00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:vvy00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1503963..1504730
Genome map
AA seq 255 aa AA seqDB search
MKFKALALLLTAPLFAQAKSLNTISSYEDNYALGTYTSDINDEAYEASGSGMDNLQHFEV
KFQLSVSVPLYRFNKATAVVGSYTQKSLWQLANSDISSPFRETNYKPQLFIAHQSNMLIF
NHLEAGYKHESNGRSSALSRSWDRLYLAAERLDGPLEYGVHLWSVVGDTSENRDIEDYYA
PYEIWMKLYSAAGIFNARGFYNWDDSRGGVEVGYTFYFNDLIGIYIQAYHGYGETLIDYD
HNQTRIGAGFKLVRW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaaagcgctcgcattgctcttaaccgcccctttgtttgctcaggcgaaaagc
ctcaataccatttccagttatgaagataactatgcgcttggcacttatacctccgatatc
aatgatgaagcctatgaagccagtggttccggcatggataatttgcagcacttcgaagtg
aagtttcagctctcggtttcggttcccctctatcgatttaataaagccactgccgtcgtg
ggttcctatacgcaaaaatccctttggcaattggccaattctgatatctcttctcccttt
agagaaaccaactataagccccagctgtttattgctcatcaaagcaatatgctgatcttt
aaccatttggaggcgggctataagcacgagtctaatggtcgttcatcggcgttatctcgt
agttgggatcgtctctaccttgctgcagagcgtttggatgggccgttggagtacggtgtg
cacctttggtctgtggtgggggatacatcagaaaaccgagatattgaagattactacgca
ccgtatgaaatttggatgaagctttacagcgcggcaggcatatttaatgctcgaggattc
tacaattgggatgacagccgtggtggcgtagaagtgggctataccttttactttaatgat
ctgattggcatctacattcaggcgtaccatggttatggtgaaactctgatcgattatgac
cacaatcaaactcggatcggtgccggtttcaagctggtacgctggtaa

DBGET integrated database retrieval system