KEGG   Vibrio vulnificus YJ016: VV1466Help
Entry
VV1466            CDS       T00150                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VV1466
   00565 Ether lipid metabolism
    VV1466
   00590 Arachidonic acid metabolism
    VV1466
   00591 Linoleic acid metabolism
    VV1466
   00592 alpha-Linolenic acid metabolism
    VV1466
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VV1466
    3.1.1.32  phospholipase A1
     VV1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1503963..1504730
Genome map
AA seq 255 aa AA seqDB search
MKFKALALLLTAPLFAQAKSLNTISSYEDNYALGTYTSDINDEAYEASGSGMDNLQHFEV
KFQLSVSVPLYRFNKATAVVGSYTQKSLWQLANSDISSPFRETNYKPQLFIAHQSNMLIF
NHLEAGYKHESNGRSSALSRSWDRLYLAAERLDGPLEYGVHLWSVVGDTSENRDIEDYYA
PYEIWMKLYSAAGIFNARGFYNWDDSRGGVEVGYTFYFNDLIGIYIQAYHGYGETLIDYD
HNQTRIGAGFKLVRW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaaagcgctcgcattgctcttaaccgcccctttgtttgctcaggcgaaaagc
ctcaataccatttccagttatgaagataactatgcgcttggcacttatacctccgatatc
aatgatgaagcctatgaagccagtggttccggcatggataatttgcagcacttcgaagtg
aagtttcagctctcggtttcggttcccctctatcgatttaataaagccactgccgtcgtg
ggttcctatacgcaaaaatccctttggcaattggccaattctgatatctcttctcccttt
agagaaaccaactataagccccagctgtttattgctcatcaaagcaatatgctgatcttt
aaccatttggaggcgggctataagcacgagtctaatggtcgttcatcggcgttatctcgt
agttgggatcgtctctaccttgctgcagagcgtttggatgggccgttggagtacggtgtg
cacctttggtctgtggtgggggatacatcagaaaaccgagatattgaagattactacgca
ccgtatgaaatttggatgaagctttacagcgcggcaggcatatttaatgctcgaggattc
tacaattgggatgacagccgtggtggcgtagaagtgggctataccttttactttaatgat
ctgattggcatctacattcaggcgtaccatggttatggtgaaactctgatcgattatgac
cacaatcaaactcggatcggtgccggtttcaagctggtacgctggtaa

DBGET integrated database retrieval system