KEGG   Vibrio vulnificus YJ016: VV1987Help
Entry
VV1987            CDS       T00150                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VV1987
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VV1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1985128..1986063
Genome map
AA seq 311 aa AA seqDB search
MNDLFTKTDYSLYSNSMSFVRRPYVKDPVAADADLVVFGAPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNLFKKVKVIDGGDLVFDCGDAEDFTYRMEAATSAILKSGKTML
GLGGDHFITLPILRAYAKHYGEMALIHFDAHTDTYANGSSYDHGTMFYHAPKEGLISPKH
SVQVGIRTEYKQEGHGFNVINAMQANDMSVEEILADIRRIVADKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNSDKILKIIRGLKDVNIVGMDVVEVSPPYDQSDLTALAGATIALELMYA
WAANKEFESEF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaactgattattcactctactcaaactcgatgagttttgtg
cgtcgtccgtatgtcaaagatcctgtcgcagcagacgctgacctcgttgtttttggtgca
ccgctagacatggcaacctctggtcgtcctggcgcgcgtatgggcccagatgcgatccgt
cgtgcatcggtgaatcttgcatgggaaggtaagaaattcccttgggatttcaacctattc
aaaaaagtgaaagtgattgacggtggcgatcttgtcttcgattgtggtgatgcagaagac
ttcacttaccgtatggaagcagcgacctctgcgatcctaaaaagtggcaaaacaatgctt
ggccttggtggtgatcacttcatcacgctgcctattctgcgcgcttacgcaaaacactac
ggtgaaatggcactgatccacttcgatgcgcacaccgacacgtacgcaaacggcagcagc
tatgaccacggcaccatgttctaccacgcgccaaaagaagggcttatctctcctaagcat
tcagtacaagtcggtatccgtactgagtacaagcaagaaggtcacggctttaacgtcatc
aatgcgatgcaagccaacgacatgagcgtagaagagatccttgcagatatccgccgcatc
gtggcagataagccggtgtatgtgacgtttgatatcgactgtctcgatccggcttttgca
ccaggaactggtacacctgtctgcggtggcttgaactcggacaagattttgaaaatcatc
cgtggcctaaaagacgttaacatcgttggtatggatgtggtggaagtctctcctccatac
gatcaaagcgatttgactgcactggctggcgcaaccatcgcgctggaactgatgtacgct
tgggcagcgaataaagagtttgaatcagagttctaa

DBGET integrated database retrieval system