KEGG   Vibrio vulnificus YJ016: VV2175Help
Entry
VV2175            CDS       T00150                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VV2175
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV2175
  Lipid metabolism
   00071 Fatty acid degradation
    VV2175
  Amino acid metabolism
   00350 Tyrosine metabolism
    VV2175
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VV2175
   00626 Naphthalene degradation
    VV2175
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VV2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2184765..2185913)
Genome map
AA seq 382 aa AA seqDB search
MAFALNLPKLSYSGVGAVDDAIATLSQQPIKRALVVTDHNLVELGILDHLFELLDEFSID
YELFDKVTPNPTATLVREGLAVYNDTGCDCFIAVGGGSPVDCAKAIRIVASNPGDIVDFD
GVGKVKSAGDFFIAINTTAGTAAEMTSNSVITDESRQVKMVIIDAKQIPDVAVNDPTLMV
NLPPHVTAATGMDALTHAVEAYVTPGAHTLTKPTALEAIKLIAQWLPIAVEDGKNLEARE
QLANAQFLAGMAFNSAGLGLVHAMAHQPGATHNLPHGVCNAILLPQVCEFNAEKYPQRFR
DIASVMGGKTEGLSDREAADLAVNLMRNLSKRVNIPSGFSLLGISRADCELWIEKALADP
CLGGNPRQPTASEVESLYLACM
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgcactaaatcttcctaaattgagttactcaggtgtcggagcggtcgatgat
gcgatcgcaacgctaagccaacagccaatcaaacgcgcgttagtggtaacggaccataat
ctggtcgaactgggcatcttggatcatttgtttgagttgcttgatgagttctctattgac
tacgagttgtttgacaaagtgacgccaaatccaactgcaacgttagtgcgagaaggatta
gcggtttacaacgatactggctgcgattgtttcatcgcagtcgggggcggtagcccagtc
gattgtgccaaagcgatccgtattgtggcgtctaacccaggtgatatcgttgattttgat
ggggttggcaaagtgaagagtgctggtgatttcttcattgccatcaataccaccgcaggg
accgcggccgagatgacctcgaactcggtgatcactgatgagtcgcgccaagtaaaaatg
gtcattattgacgccaaacagatccctgatgtcgcggttaatgacccgacgttgatggtc
aatttgccaccgcacgtaaccgccgcgacggggatggatgcgctcactcacgcggtggaa
gcctatgtcacaccaggcgcacataccttaactaaaccgactgcgcttgaggcaatcaaa
ctgattgcccagtggttacctatcgcggttgaagatggtaaaaatcttgaagcgcgcgag
caattggctaacgctcagttcttagcgggcatggcgtttaacagtgcgggtttggggtta
gtgcacgccatggctcatcaacctggcgcgactcataatttacctcatggggtgtgcaat
gcgattttgctgccgcaagtgtgtgaatttaacgccgagaaatatcctcaacgttttcgc
gatatcgcttcggtgatgggtgggaaaacggaggggctgagcgatagagaagctgccgat
ttagccgttaatctgatgcggaatttgtcaaaacgagtcaacattcctagcggtttttct
ttgcttggaataagtcgagcagattgcgagctgtggatagagaaagccctggctgacccg
tgtctggggggaaaccctcgccagccaacagccagtgaagtagagtcactctaccttgcg
tgtatgtaa

DBGET integrated database retrieval system