KEGG   Vibrio vulnificus YJ016: VV2179Help
Entry
VV2179            CDS       T00150                                 

Definition
(GenBank) L-fucose isomerase
  KO
K01818  
L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VV2179
Enzymes [BR:vvy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     VV2179
    5.3.1.25  L-fucose isomerase
     VV2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(2188519..2190267)
Genome map
AA seq 582 aa AA seqDB search
MSNLVKIGIRPTIDGRRLGVRESLEEQTMNMAKNLANFIAENVRHVSGDAVECVIADSTI
GGVAEAAACADKFKRENVGLSITVTPCWCYGTETIDMDPHMPKAIWGFNGTERPGAVYLA
AAMAGHSQVGLPAFSIYGEEVQDKDDTSIPSDVQEKILRFCRAGLTVATIRGKSYLSMGS
VSMGIAGSIVDQPFFQHYLGMRNEYVDMTEIKRRLDREIFDKEEFELAMAWTKEHCHEGK
DYNREPMSEARKQEDWQTVVKMTMIMRDLMEGNPKLAEMGFGEEALGHNAVVGGFQGQRH
WTDHLPNGDFSEAILNSSFDWNGIREPFVIATENDSLNGVNMLFGKMLTGQAQVFCDVRT
YWSADSVERVSGYRPESGFIHLVNSGSAALDGCGEAKLTSGESAIKPHWQMSAQDAEACL
SATKWPPADVEYFRGGGFSSNFLTHGGMPFTMHRINIIKGIGPVLQIAEGHSITLPQEVH
ETLNERTNPTWPTTWFVPRLNDEGAFKDVYSVMANWGANHCVITYGHVGADLITLASMLR
IPVAMHNVEESDVFRPHTWSAFGQDKEGQDYRACATFGPLYK
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttagtcaaaatcggtattcgcccaacaattgatggccgtcgtttaggtgtg
cgtgagtctctagaagagcaaaccatgaacatggcgaaaaatttagccaactttatcgct
gaaaatgtccgtcatgttagcggcgacgcggtcgaatgtgtgattgcagattcaaccatc
ggcggtgtagcagaagcagccgcgtgtgcggataagttcaagcgcgaaaatgttggtctc
tctatcactgtcacaccttgctggtgttacggcacggagacgattgatatggacccacat
atgcccaaagcgatttggggctttaatggcactgaacgtccgggagcagtttacttagcc
gcagcgatggcgggtcactcccaagttggtctccctgcgttctcaatctatggtgaggaa
gtgcaagataaagacgacacttctattccatctgacgtacaagagaagatcttgcgtttc
tgccgcgccggtctgacggtggcgacgattcgcggtaaatcttacctatccatgggttcg
gtctctatgggtatcgcaggctcgattgttgatcaacccttcttccagcactacctaggt
atgcgtaatgaatacgtggatatgacggaaatcaaacgccgcctagaccgagagatcttc
gataaagaagagttcgagttagcgatggcgtggacgaaagagcattgccatgaaggtaaa
gattacaaccgtgagccaatgagtgaagcgcgtaaacaggaagattggcagacagtggtt
aagatgacgatgatcatgcgcgatctgatggaaggtaaccctaaactggcggaaatgggc
ttcggtgaagaagcactcggtcataacgccgtcgtgggaggcttccaaggccagcgtcat
tggacagaccatctgccaaatggtgactttagtgaggcgatccttaactcttcgtttgac
tggaatggcattcgtgaaccgtttgtgattgcgactgaaaacgacagcctcaatggcgtt
aacatgctgtttggcaagatgttgacaggtcaagcgcaagtgttctgcgatgttcgtact
tactggtcagcagactcggttgaacgcgtcagtggctaccgcccagaatccggctttatc
catctagttaactcaggttctgctgcgcttgatggttgtggcgaagctaagttaaccagt
ggcgagtccgccatcaaaccgcactggcagatgagcgcgcaagatgcagaggcatgcctt
agcgccaccaaatggccaccagcagatgttgaatacttccgtggcggcggtttctcttcg
aatttcctaacccatggcggcatgccatttaccatgcaccgcatcaacatcattaagggg
attggtccggttctacaaatcgcagaaggtcactcaattacgctgccgcaagaggtgcat
gaaactcttaatgagcgtaccaacccaacttggccgaccacatggtttgtgccgcgctta
aatgacgaaggagcattcaaagatgtttattcggtgatggcgaactggggcgcgaaccac
tgtgtgatcacttacggtcacgttggggctgatttgatcaccctcgcgtcgatgctgcgc
attcctgttgcgatgcacaacgtggaagagagtgacgtgttcaggcctcacacctggagt
gcattcggtcaagacaaagaaggccaagattaccgcgcttgtgcaacctttggtcctttg
tacaaataa

DBGET integrated database retrieval system