KEGG   Vibrio vulnificus YJ016: VV2285Help
Entry
VV2285            CDS       T00150                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VV2285 (ruvA)
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VV2285 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2300853..2301467)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGILLEKQPPELLIEVNGIGYEVQMPMSCFYELPNIGEEAIIYTHFVVREDAQLL
YGFNTVKERALFREVIKANGVGPKLGLAILSGMTASQFVASVEREDISTLVKLPGVGKKT
AERLVVEMKDRLKGWSAGDLFTPFTDAAPVDSGSTSSNSAEEEAVSALLALGYKPVQASK
VVSQIAKPDMTSEQLIREALKSMV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgtcttcgcggcattctgctggaaaaacaaccccctgaattgttgattgaa
gttaatggcattggctatgaagttcagatgccaatgagttgtttctacgagcttcctaac
attggggaagaagccattatctatactcattttgtggtgcgtgaagatgctcagttactt
tatggattcaataccgtgaaagaacgagcgctgtttagagaagtcatcaaagccaatggg
gttggaccaaaactgggtttggccattttatcaggcatgacggcaagccagtttgtggcg
tcggtagaaagagaagacatttccacgctggtgaaattaccgggcgttggcaagaagacc
gcagaacgtcttgtggttgagatgaaagatcgtttgaaaggttggagcgctggcgatctg
ttcacgccgtttaccgatgcggcgccagttgattcaggcagcacaagcagtaacagcgca
gaagaagaagcggtcagtgcgctcttggcgttgggatataagcctgtacaggcatcaaaa
gtagtatcgcagattgctaaaccggatatgaccagtgaacaactgatccgcgaagcgctt
aaatccatggtctaa

DBGET integrated database retrieval system