KEGG   Vibrio vulnificus YJ016: VV2440Help
Entry
VV2440            CDS       T00150                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV2440 (fadJ)
   01212 Fatty acid metabolism
    VV2440 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VV2440 (fadJ)
   00650 Butanoate metabolism
    VV2440 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    VV2440 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    VV2440 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VV2440 (fadJ)
   00310 Lysine degradation
    VV2440 (fadJ)
   00380 Tryptophan metabolism
    VV2440 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VV2440 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VV2440 (fadJ)
   00281 Geraniol degradation
    VV2440 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VV2440 (fadJ)
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VV2440 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VV2440 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VV2440 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2473244..2475361)
Genome map
AA seq 705 aa AA seqDB search
MSEQKAFNLKIDEQNIAWLGIDVPNEKMNTLQAAFADEMKAIFAQLKDSSGLKGLIVHSL
KPDNFVAGADVRMLEACKTAPEAEALARQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDFRVCSDDDATRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPQTILLDVAKQFVEKGKKRAKQKVTTKEKLLSGSGLGRKFVFEQAAKKTHE
KTRGNYPATVAILQVIQHGLEKGMKQGLELEAKRFGELVMSNESKALRSIFFATTEMKKE
TGSEAKPSKVGMVGVLGGGLMGAGISHVSVAKAKVPVRIKDVSNDGVLNALKYNYKLFDK
QRKRRILSKAQLQSKMLQLSGGTDFTSFNRTDVVIEAVFEDLSLKQQMVADIEANAKPET
IFATNTSSLPIHKIAEKAQRPENIVGLHYFSPVEKMPLVEVIPHESTSEETIATVVALAK
KQGKTPIVVKDQAGFYVNRILAPYMNESAHILLANEPIDKIDTALLDFGFPVGPITLLDE
VGVDIGAKIMPILVAELGARFKGPDVFDVLLNDGRKGRKSGKGFYTYKGKKKEVDKSVYK
LLKLTPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGLKELVEKMNQFAEKYGDRFAPCDGLLTRAGEGRRFYDN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaaaaagcgtttaatctaaagattgatgagcagaacattgcgtggcttggc
attgatgttccaaacgaaaaaatgaatacccttcaagcggcttttgccgatgaaatgaag
gcgatttttgctcaactgaaagacagcagtggcctgaaagggctgatcgtgcattcgttg
aaacctgacaactttgttgcaggcgcggatgttcgaatgctagaagcgtgcaaaacggct
cctgaagcagaagcccttgcacgccaaggacaagagttatttcaacaactttctgatttg
ccttatccagtggtggctgcaatccatggcccgtgtctgggtggcggtttggaattagcg
ttagcgtgtgattttcgtgtgtgtagtgacgacgacgccactcgtcttggtttaccagaa
gtccagcttggtctattaccgggctctggtggtactcagcgtctccctcgtttgattggt
cttcttccttcattggatctgatcctgacgggtaaacagcttcgagccaagaaagccaag
aaattgggcgttgttgatgcctgtgtgccacaaactattttgttggatgtggcgaagcag
tttgttgaaaaaggcaagaagcgcgcaaaacaaaaagtgacgacaaaagagaaattgctc
tctgggagtgggctagggcgtaagtttgtgtttgaacaagcggcgaaaaaaacgcacgaa
aaaacacgtggtaactaccctgcgactgtcgccattttgcaagtcatccagcatggcctt
gaaaaaggaatgaaacagggcttggagctggaagcgaagcgctttggtgagttggtcatg
agcaacgagtcgaaggctttgcgttcgattttctttgccaccacggaaatgaaaaaagaa
acgggcagtgaagcaaaaccaagtaaagtcggaatggtcggcgtacttggcggcggcttg
atgggtgcgggtatcagtcatgtcagtgtggcgaaagccaaagtgccagtacgcattaaa
gacgtcagcaatgacggcgtgctgaacgccttgaaatacaactacaagttgtttgataag
cagcgcaaacgtcgcattctctccaaggcgcaactgcagagcaaaatgctgcaattgagc
ggaggaaccgatttcaccagctttaaccgtaccgacgtggtgattgaagcggtctttgaa
gatctgtcgctcaagcaacaaatggtggcggacattgaagcaaatgcgaagccggagact
atcttcgcgacgaatacctcttctttgccaatccataaaattgccgagaaggcgcagcgg
cctgagaacattgtgggtttgcactactttagtccggtagagaaaatgcccttggtggaa
gtcattccgcatgaatcaacgtcggaagaaaccattgccacggtggttgctttggcgaag
aaacaaggcaaaacgccgattgtggtgaaagatcaagcgggtttctatgtgaaccgaatt
cttgcgccgtacatgaatgaatctgcgcacattttgctagcaaatgagccgatcgataag
atcgatactgcgttgttggattttggcttccctgtcggtccaattacgttgctggatgaa
gtgggtgtagatattggtgcgaagatcatgcctatccttgtcgctgagttgggtgctcgc
tttaaagggccggatgtgtttgatgtgcttctcaatgatggccgcaaaggtcgcaagagc
ggaaaaggcttctacacctataaaggcaagaagaaagaagtggataagtccgtttacaaa
ctgctgaaactcaccccagagtcgaagctgagcgacaatgacattgcgctgcgttgtgtg
ttgccaatgctcaacgaagcggtacgctgtttggatgatggcattattcgttctcctcgc
gatggcgacattggggctatcttcggtatcggcttccctcctttcttaggtggcccgttc
cgttatatggaccaatttggtttgaaggaactggtagagaaaatgaaccaattcgctgag
aaatatggcgatcgctttgcgccgtgtgatggtttactcacgcgtgcgggagaaggacgt
cgtttctatgacaactag

DBGET integrated database retrieval system