KEGG   Vibrio vulnificus YJ016: VV2613Help
Entry
VV2613            CDS       T00150                                 

Definition
(GenBank) ATP-dependent exoDNAse alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VV2613
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VV2613
DNA repair and recombination proteins [BR:vvy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     VV2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 UvrD-helicase DUF2075 AAA_22 UvrD_C AAA_28 AAA_16 T2SSE CbiA AAA_29 TrwB_AAD_bind NTPase_1 MukB ResIII DEAD DUF87 AAA SRP54 ATPase
Motif
Other DBs
NCBI-ProteinID: BAC95377
UniProt: Q7MIA4
Position
I:complement(2636012..2638126)
Genome map
AA seq 704 aa AA seqDB search
MMLNGSLQATLSMLEQQAQQGYLRLLDYQFARFIGEQSQHSGLALLAAAVSAELGKGHIC
LPLLDELGQVCELASKIGLFGEAATELNAQLQLIDWRALLQTSGLVGTQGEAVPLMFDGE
RVYLHRYWHYEVVLAQKLNQLSHGIELNASSAASLSALLDRLFARDYRFLFETLIAAQAS
GSTQVQRQQWVCDFLDVVEEHRLDWTAIEQVLSQVSKVSDLNALDHLVPHAACINWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQAGAQTPTIRLVAPTGKAAARLTESIG
KAVQSLAVEPSLKALIPTEASTLHRLLGAIPGSAEFRHHSQNPLHLDVLVVDEASMVDLS
MMYKVIDALPKHARLILLGDKDQLASVEAGAVLGDICAFSASGYSAEQAATLAKLTGYQA
LPKSASRLAPVADSLCMLQKSYRFDARSGIGQLAKAINAGSVAALESVWQREFSDIARHP
LDASHYNHMLQTLVSEYSHYLARIALTQQHLEPKERESSAERAKAGLNLFHRCRLLCAVR
EGNFGVAGLNLRIERALAARNLIKVKDEIWYHGRPVMVTRNDYALGLYNGDIGICMWDDT
DEDPRLKVYFELADGSVKAVLPSRVPEHETAYAMTIHKSQGSEFDFTLMILPADFSPILT
RELIYTGITRAKKRLALYADLQVLKRGMKIKTQRASGLPHRLGQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgaatgggtcactccaagcgacgctgtcgatgctggaacagcaagcccaacaa
ggctacctgcgcttattggattatcaatttgcgcgctttattggtgagcagagtcagcac
agcggattggcgctgttggccgctgcggtcagcgccgagttaggcaaagggcatatttgc
ttgcctctgttggatgaacttggccaagtctgtgaattggccagcaaaattggcctgttt
ggtgaggcggcaaccgagctgaacgcccagcttcagctgatcgactggcgagcgttgctg
caaaccagtggcttggtcggcacgcaaggggaagcggtgcccttgatgttcgatggtgaa
cgagtttatctgcatcgctattggcactatgaagtcgttttggcgcaaaaacttaatcaa
ttaagccacggtattgagcttaatgccagctcggcggcatcgttgtccgcactgctggat
cgattgttcgcgcgagattaccgctttttgttcgaaacgctgattgccgcgcaagcgagc
ggcagtacccaagtgcagcgacagcaatgggtgtgtgattttctcgacgtggttgaagag
caccgtttggattggacggcgattgaacaagtgctgagccaagtaagcaaagtctcagat
ctcaacgcgctggatcatctcgtgcctcatgcggcctgcattaattggcaaaaggtggct
gccgcagtggcgttgacgcgtcgttttgccgtgatctctggggggccgggaacaggcaaa
accaccaccgtcacgaaattgttggcggcgctgattgagcaagctggagcgcaaacgccc
accattcgtttggtggcgccaacgggtaaagcggcggcgcgtttgaccgaatccatcggt
aaagcggtgcaatctttagccgtagagccgagtttaaaggcgttaatccccacagaagcc
tcaacattacatcgcttgttaggcgcgatccccggcagtgccgagtttcgtcatcacagt
caaaacccgctgcatttggatgtactggtggtggatgaagcctcaatggtcgatctttcg
atgatgtataaagtgattgacgcgctgcctaaacatgctcgtttgattttactcggtgat
aaagatcagttggcctccgttgaagcgggggcggtgctgggggatatctgcgcattttct
gcttccggatacagcgcagagcaagcggcaacgctcgcgaagttaacgggttatcaagcg
ctgccaaagagtgccagccgtttagcgccagtcgctgatagcttgtgtatgttgcaaaag
agctatcgttttgacgctcgctcagggattggccaattggcaaaagcgatcaatgcaggt
tcagtggcggcgttagagagtgtatggcagcgagagtttagcgatatcgcgcgtcatcca
ttggatgccagccattacaaccatatgttgcaaacactagtgagtgagtactcacattat
cttgctcgcattgccttaactcagcagcatcttgaacccaaagagagagaaagcagcgcg
gaacgagccaaagcgggactgaatttgtttcatcgttgccggttactttgcgccgtgcgt
gaagggaattttggtgtggccgggcttaaccttcgcattgaaagagccttagctgcgcgg
aatttgattaaagtgaaggatgagatttggtatcacggcaggcctgtgatggtgacgcgt
aatgattacgcgcttgggctttacaacggcgacattggcatctgcatgtgggatgacact
gatgaagacccgcgtctaaaagtctattttgagttggctgacggcagcgttaaagcggta
ttaccaagccgagtaccagaacatgaaacagcctatgcgatgacaatacataaatcgcaa
ggcagcgaatttgattttaccttgatgattttgccagccgatttcagcccaatactgacg
cgagagctgatctacacgggcattactcgagcgaaaaagcgtttagcgctgtatgccgat
ctccaagtcctgaaacgtggtatgaagataaaaacacagcgagcgagcggcctgccacac
cgtttgggccagtaa

DBGET integrated database retrieval system