KEGG   Vibrio vulnificus YJ016: VV2613Help
Entry
VV2613            CDS       T00150                                 

Definition
ATP-dependent exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VV2613
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VV2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2636012..2638126)
Genome map
AA seq 704 aa AA seqDB search
MMLNGSLQATLSMLEQQAQQGYLRLLDYQFARFIGEQSQHSGLALLAAAVSAELGKGHIC
LPLLDELGQVCELASKIGLFGEAATELNAQLQLIDWRALLQTSGLVGTQGEAVPLMFDGE
RVYLHRYWHYEVVLAQKLNQLSHGIELNASSAASLSALLDRLFARDYRFLFETLIAAQAS
GSTQVQRQQWVCDFLDVVEEHRLDWTAIEQVLSQVSKVSDLNALDHLVPHAACINWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQAGAQTPTIRLVAPTGKAAARLTESIG
KAVQSLAVEPSLKALIPTEASTLHRLLGAIPGSAEFRHHSQNPLHLDVLVVDEASMVDLS
MMYKVIDALPKHARLILLGDKDQLASVEAGAVLGDICAFSASGYSAEQAATLAKLTGYQA
LPKSASRLAPVADSLCMLQKSYRFDARSGIGQLAKAINAGSVAALESVWQREFSDIARHP
LDASHYNHMLQTLVSEYSHYLARIALTQQHLEPKERESSAERAKAGLNLFHRCRLLCAVR
EGNFGVAGLNLRIERALAARNLIKVKDEIWYHGRPVMVTRNDYALGLYNGDIGICMWDDT
DEDPRLKVYFELADGSVKAVLPSRVPEHETAYAMTIHKSQGSEFDFTLMILPADFSPILT
RELIYTGITRAKKRLALYADLQVLKRGMKIKTQRASGLPHRLGQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgaatgggtcactccaagcgacgctgtcgatgctggaacagcaagcccaacaa
ggctacctgcgcttattggattatcaatttgcgcgctttattggtgagcagagtcagcac
agcggattggcgctgttggccgctgcggtcagcgccgagttaggcaaagggcatatttgc
ttgcctctgttggatgaacttggccaagtctgtgaattggccagcaaaattggcctgttt
ggtgaggcggcaaccgagctgaacgcccagcttcagctgatcgactggcgagcgttgctg
caaaccagtggcttggtcggcacgcaaggggaagcggtgcccttgatgttcgatggtgaa
cgagtttatctgcatcgctattggcactatgaagtcgttttggcgcaaaaacttaatcaa
ttaagccacggtattgagcttaatgccagctcggcggcatcgttgtccgcactgctggat
cgattgttcgcgcgagattaccgctttttgttcgaaacgctgattgccgcgcaagcgagc
ggcagtacccaagtgcagcgacagcaatgggtgtgtgattttctcgacgtggttgaagag
caccgtttggattggacggcgattgaacaagtgctgagccaagtaagcaaagtctcagat
ctcaacgcgctggatcatctcgtgcctcatgcggcctgcattaattggcaaaaggtggct
gccgcagtggcgttgacgcgtcgttttgccgtgatctctggggggccgggaacaggcaaa
accaccaccgtcacgaaattgttggcggcgctgattgagcaagctggagcgcaaacgccc
accattcgtttggtggcgccaacgggtaaagcggcggcgcgtttgaccgaatccatcggt
aaagcggtgcaatctttagccgtagagccgagtttaaaggcgttaatccccacagaagcc
tcaacattacatcgcttgttaggcgcgatccccggcagtgccgagtttcgtcatcacagt
caaaacccgctgcatttggatgtactggtggtggatgaagcctcaatggtcgatctttcg
atgatgtataaagtgattgacgcgctgcctaaacatgctcgtttgattttactcggtgat
aaagatcagttggcctccgttgaagcgggggcggtgctgggggatatctgcgcattttct
gcttccggatacagcgcagagcaagcggcaacgctcgcgaagttaacgggttatcaagcg
ctgccaaagagtgccagccgtttagcgccagtcgctgatagcttgtgtatgttgcaaaag
agctatcgttttgacgctcgctcagggattggccaattggcaaaagcgatcaatgcaggt
tcagtggcggcgttagagagtgtatggcagcgagagtttagcgatatcgcgcgtcatcca
ttggatgccagccattacaaccatatgttgcaaacactagtgagtgagtactcacattat
cttgctcgcattgccttaactcagcagcatcttgaacccaaagagagagaaagcagcgcg
gaacgagccaaagcgggactgaatttgtttcatcgttgccggttactttgcgccgtgcgt
gaagggaattttggtgtggccgggcttaaccttcgcattgaaagagccttagctgcgcgg
aatttgattaaagtgaaggatgagatttggtatcacggcaggcctgtgatggtgacgcgt
aatgattacgcgcttgggctttacaacggcgacattggcatctgcatgtgggatgacact
gatgaagacccgcgtctaaaagtctattttgagttggctgacggcagcgttaaagcggta
ttaccaagccgagtaccagaacatgaaacagcctatgcgatgacaatacataaatcgcaa
ggcagcgaatttgattttaccttgatgattttgccagccgatttcagcccaatactgacg
cgagagctgatctacacgggcattactcgagcgaaaaagcgtttagcgctgtatgccgat
ctccaagtcctgaaacgtggtatgaagataaaaacacagcgagcgagcggcctgccacac
cgtttgggccagtaa

DBGET integrated database retrieval system