KEGG   Vibrio vulnificus YJ016: VV2624Help
Entry
VV2624            CDS       T00150                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VV2624 (glpK)
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VV2624 (glpK)
Exosome [BR:vvy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VV2624 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2652801..2654318
Genome map
AA seq 505 aa AA seqDB search
MTEQKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKKGIRSDQVAAIGITNQRETTIVWNKETGKPVYNAIVWQCRRTADICEDLKARG
LESYIRENTGLVLDPYFSGTKVKWILDNVEGAREDAEAGKLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINDLCWDSKLLEEMGIPASMMPEVKRSSEIYGQTNIGGKGGTRIPI
SGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMNTGQEKVTSRNGLLTTLACGPKGEPA
YALEGAVFMGGASIQWLRDELKLISDAHDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQSDVLDTEVHRPKVTEVTALGAAYLAGLAVGYWNSIDELQGKAEIDRSFLPHQDEEKR
SRRYKGWKRAVKCAQTWSELRDLED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcagaagtacatcgttgcactggaccaaggcaccaccagctctcgtgctgtg
gttttagatcacgacgcgaacatcgtttctgtctcccagcgcgaattcactcagatttac
ccacaagcaggctgggtagaacatgatccaatggaaatttacgccactcagagctctaca
ctcgttgaagcattgggtaaaaagggcatccgcagtgaccaagtggctgccatcggtatc
accaaccaacgtgaaaccaccatcgtttggaacaaagaaacaggcaaaccggtttacaac
gccattgtttggcagtgccgtcgtaccgccgatatctgtgaggacctaaaagcgcgcgga
ttggaatcttacattcgcgaaaacaccggccttgtacttgacccttacttctcgggcacc
aaagtaaagtggattctcgataatgttgaaggggcacgtgaagacgccgaagcgggtaaa
ctgctgtttggtaccgttgatacttggctggtctggaagatgacccaaggccgcgtgcac
gtcaccgactacaccaacgcctcccgcaccatgctgttcaacatcaatgacctatgttgg
gatagcaaactgctcgaagaaatgggcatcccagcgtcgatgatgccggaagtaaaacgc
tcatcggaaatttacggccaaaccaacatcggtggtaaaggcggtacgcgtattcctatc
tcaggcattgcgggtgaccaacaagcggcgctgtacggccaaatgtgtgtcgaagctggc
caagcgaaaaatacctacggaactggctgtttcttgttgatgaacaccggacaagagaaa
gtgacctcacgcaacggtttgttgaccacactcgcgtgtggaccaaaaggtgagccagcc
tacgcactggaaggtgcggtatttatgggcggcgcttcgattcagtggctgcgtgatgag
ctgaaactgatttccgatgcgcacgattccgaatacttcgccacaaaagtggacacctca
aacggcgtgtatgtggtgccagcctttacgggcttaggcgctccgtactgggatgcctat
gctcgcggtaccattgttggcctcactcgtggcgttaactcaaaccacatcatccgtgca
acgttagaaggcattgcctaccaaacccgtgatgtactggacgcaatgcaagcagactca
ggcattaagctctctgccctacgcgttgatggcggcgctgtcgccaacaacttcctcatg
cagttccaatctgatgtgcttgataccgaagtgcatcgtccaaaagtcaccgaagtgacc
gcgctgggcgctgcgtacctagcaggcttggccgtggggtactggaacagcattgatgaa
cttcaaggcaaagcagagatcgaccgcagcttccttcctcatcaagatgaagagaaacgc
agccgacgctataaaggctggaaacgcgcagtcaaatgtgcgcaaacttggtctgaattg
cgcgatctcgaagattaa

DBGET integrated database retrieval system