KEGG   Vibrio vulnificus YJ016: VV2624Help
Entry
VV2624            CDS       T00150                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vvy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2652801..2654318
Genome map
AA seq 505 aa AA seqDB search
MTEQKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKKGIRSDQVAAIGITNQRETTIVWNKETGKPVYNAIVWQCRRTADICEDLKARG
LESYIRENTGLVLDPYFSGTKVKWILDNVEGAREDAEAGKLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINDLCWDSKLLEEMGIPASMMPEVKRSSEIYGQTNIGGKGGTRIPI
SGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMNTGQEKVTSRNGLLTTLACGPKGEPA
YALEGAVFMGGASIQWLRDELKLISDAHDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQSDVLDTEVHRPKVTEVTALGAAYLAGLAVGYWNSIDELQGKAEIDRSFLPHQDEEKR
SRRYKGWKRAVKCAQTWSELRDLED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcagaagtacatcgttgcactggaccaaggcaccaccagctctcgtgctgtg
gttttagatcacgacgcgaacatcgtttctgtctcccagcgcgaattcactcagatttac
ccacaagcaggctgggtagaacatgatccaatggaaatttacgccactcagagctctaca
ctcgttgaagcattgggtaaaaagggcatccgcagtgaccaagtggctgccatcggtatc
accaaccaacgtgaaaccaccatcgtttggaacaaagaaacaggcaaaccggtttacaac
gccattgtttggcagtgccgtcgtaccgccgatatctgtgaggacctaaaagcgcgcgga
ttggaatcttacattcgcgaaaacaccggccttgtacttgacccttacttctcgggcacc
aaagtaaagtggattctcgataatgttgaaggggcacgtgaagacgccgaagcgggtaaa
ctgctgtttggtaccgttgatacttggctggtctggaagatgacccaaggccgcgtgcac
gtcaccgactacaccaacgcctcccgcaccatgctgttcaacatcaatgacctatgttgg
gatagcaaactgctcgaagaaatgggcatcccagcgtcgatgatgccggaagtaaaacgc
tcatcggaaatttacggccaaaccaacatcggtggtaaaggcggtacgcgtattcctatc
tcaggcattgcgggtgaccaacaagcggcgctgtacggccaaatgtgtgtcgaagctggc
caagcgaaaaatacctacggaactggctgtttcttgttgatgaacaccggacaagagaaa
gtgacctcacgcaacggtttgttgaccacactcgcgtgtggaccaaaaggtgagccagcc
tacgcactggaaggtgcggtatttatgggcggcgcttcgattcagtggctgcgtgatgag
ctgaaactgatttccgatgcgcacgattccgaatacttcgccacaaaagtggacacctca
aacggcgtgtatgtggtgccagcctttacgggcttaggcgctccgtactgggatgcctat
gctcgcggtaccattgttggcctcactcgtggcgttaactcaaaccacatcatccgtgca
acgttagaaggcattgcctaccaaacccgtgatgtactggacgcaatgcaagcagactca
ggcattaagctctctgccctacgcgttgatggcggcgctgtcgccaacaacttcctcatg
cagttccaatctgatgtgcttgataccgaagtgcatcgtccaaaagtcaccgaagtgacc
gcgctgggcgctgcgtacctagcaggcttggccgtggggtactggaacagcattgatgaa
cttcaaggcaaagcagagatcgaccgcagcttccttcctcatcaagatgaagagaaacgc
agccgacgctataaaggctggaaacgcgcagtcaaatgtgcgcaaacttggtctgaattg
cgcgatctcgaagattaa

DBGET integrated database retrieval system