KEGG   Vibrio vulnificus YJ016: VV2642Help
Entry
VV2642            CDS       T00150                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VV2642 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VV2642 (ebgA)
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VV2642 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2673088..2676186
Genome map
AA seq 1032 aa AA seqDB search
MNNWENFLHLHENRMAPRAYFFSYDTVQQAQTFQRELSSRFMLLSGQWQFHYFSNPMLVP
DEFYSQTMSDWGHITVPNMWQMEGHGDLQYTDEGFPFPIDVPFVPTDNPTGAYQRTFTLG
PQWDDKQTIIKFDGVETYFEVYVNGHYVGFSKGSRLTAEFDISAYAQPGENLLSVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLVGKEPVHVQDLTIRTDFADDYQSATLSAQVELENLST
AIASGYTLEYALHDKGTVVASGQCDSLTIQNRHSANFAIDMVNPTHWTAENPYLYHLFIT
LKDHQGKVVEVIPQRVGFRDIKVRDGLFYINNQYVMLHGVNRHDNDHLKGRAVGMDRVEK
DLMLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVETHGFANVGDLSRITNDPA
WEAVFVDRAVRHVHAQKNHPSIIMWSLGNESGYGCNIRAMYAATKALDDTRLVHYEEDRD
AEVVDVISTMYSRAQLMNYFGEHPHEKPRIICEYAHAMGNGPGGLTEYQNVFYAHDHIQG
HYVWEWCDHGILARDEHGQEFYKYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLKEYKQVI
APVKIRAVEGCHDRFIVENKLWFTNLDDYTITAEIRAEGDTLRSVPFKVEALAANSAREV
SIDLPELDEREAFINFTVRKDSRTLYSEANHDIAVYQFQLKENTAMLPALVNHNVQPLVL
EESRLEHVITGHNFTLTFSKVNGKLTSWRVNGEELIQSEPRLNFFKPMIDNHKQEYEGLW
HPAHLQIMQEHFRTLSVDASEDAILITTTSIVAPPVFDFGMRCTYRYQINAQGHLNVELS
GERYGDYPHVIPVIGLDLGINGRFDQVSYYGRGPEENYQDSRQANLIDVYHTNVADMFEN
YPFPQNNGNRQHVRWASLTNRHGSGLLVKPQQELNFSAWFYTNQNLHQAQHTIELEKSGY
ITLNLDHQVMGLGSNSWGSEVLDSYRVYMDAFRYGLTLMPLQAGDCSAQVMANHDFDNAF
FTSTDTKIVNEA
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaactgggaaaacttcctccatttacatgagaacagaatggcgccgcgtgcgtac
ttcttctcctatgataccgttcaacaagctcaaacctttcagcgtgagttgagcagccgc
tttatgctgctaagtggtcaatggcaatttcattacttcagcaacccaatgctggtgcct
gatgagttttactcacaaaccatgagcgattgggggcacattaccgtacccaacatgtgg
caaatggaaggccacggcgatcttcaatacactgacgaaggtttcccattcccaattgac
gtaccttttgtacccaccgacaacccaacgggcgcttatcagcgcactttcactttgggc
cctcaatgggacgacaaacagaccatcatcaagttcgatggcgtggaaacctacttcgag
gtgtacgtcaacggccactatgtcggttttagtaaaggcagccgtcttactgcagagttc
gacatttctgcctacgcacaaccaggtgaaaacttgctctctgtacgcgtgatgcaatgg
gccgattcgacttacattgaagaccaagacatgtggtggacggcggggatcttccgtgat
gtttaccttgtcggcaaagagccggttcatgtccaagatctcaccattcgcaccgatttc
gccgacgattaccaaagtgcgacgctcagtgctcaggttgaattggaaaatctttctacc
gcgattgcgtctggctatacactggaatacgcactgcatgacaaaggcactgtcgtagcc
agtggtcaatgcgattcactgactatccaaaaccgccattcagccaacttcgccattgat
atggtgaacccaacgcattggacagcggaaaatccttacctttaccacttgttcattacc
ttaaaagatcaccaaggcaaggtcgtggaagtgatcccacaacgcgtgggtttccgtgac
atcaaagttcgcgatggcctgttctacatcaacaatcaatacgtgatgctgcacggtgtc
aaccgtcatgacaacgaccacctaaaaggtcgtgcagtaggcatggaccgcgtggaaaaa
gatctgatgttgatgaagcaacacaacatcaactcggttcgcaccgcacactacccgaac
gacccacgcttctacgagctgtgtgatatttacggcctgtttgtgatggcagaaaccgat
gtggaaacccacggctttgccaacgttggcgacctcagccgcatcaccaacgatccagca
tgggaagcggtgtttgttgatcgcgcagtgcgccatgtgcacgcacagaaaaaccaccca
tcgatcatcatgtggtcactcggcaatgagtctggctacggttgtaatatccgcgccatg
tacgccgcaaccaaagcccttgatgacacccgtttggtgcactacgaagaagaccgcgat
gccgaagtggtggatgtgatttccactatgtactcgcgtgcacaactgatgaattacttt
ggcgaacacccacacgagaaaccacgcatcatctgcgaatacgcccacgcgatgggtaac
gggccgggtggtctcaccgaataccaaaacgtgttttacgcgcacgaccatattcaaggc
cactacgtgtgggagtggtgtgatcacggcattctagcgcgtgatgaacacggtcaagag
ttctacaaatacggcggtgattacggcgattacccaaacaactacaacttctgtatggat
ggtctgatttacccagatcaaaccccaggcccaggcctgaaagaatacaagcaagtgatt
gcgccagtgaaaatccgcgccgttgagggttgccatgaccgcttcatcgttgagaacaaa
ctgtggttcaccaatctcgatgactacaccatcaccgctgaaattcgcgccgaaggcgac
accttgcgtagcgtgccgtttaaagtcgaagcactggccgcgaacagcgctcgtgaagtg
agcattgacttgccagaattggatgagcgcgaagccttcattaacttcaccgtacgtaaa
gacagccgcaccttgtatagcgaggccaaccacgacattgctgtgtaccagttccaactg
aaagaaaacaccgccatgttgcctgcgttagtcaaccacaatgttcaaccattggtgctt
gaagaaagccgcctagagcacgtgatcacaggtcataacttcacgctcacgttctcgaaa
gtaaacggtaaactgacctcatggcgtgtgaatggtgaagagttgattcaatcagagcca
agattgaacttcttcaaaccaatgattgataaccacaagcaagagtacgaagggttgtgg
caccctgcacatctgcaaatcatgcaagagcacttccgcacgctgagcgtggacgcgagc
gaagatgccatcctgatcaccaccaccagcattgttgcaccgcccgtgtttgattttggc
atgcgttgtacctaccgctaccaaatcaacgcgcaaggccatttgaatgtggaactgagt
ggcgagcgctacggcgactaccctcacgtgattccggtcatcggcttggatttgggcatc
aacggtcgctttgatcaagtgagctactacggtcgcggccctgaagagaactatcaagac
agccgccaagctaacctcattgatgtttaccacaccaacgtggcggacatgttcgagaac
tacccgttcccgcaaaacaacggcaaccgccagcacgtgcgttgggcatcgctcaccaac
cgtcatggcagtggtttgttggtcaagcctcagcaagagcttaacttcagtgcgtggttc
tacaccaaccaaaacctgcatcaagcacaacatacgattgagctagaaaagagtggctac
atcacgcttaaccttgaccatcaagtaatgggcttgggttcaaactcttggggcagtgaa
gtgctcgactcttaccgcgtgtatatggatgcattccgctacggcctcactctgatgcca
ttgcaagcaggcgattgcagcgcgcaagtcatggcaaaccatgatttcgacaacgcattt
ttcacttcaaccgataccaaaatcgttaacgaggcgtaa

DBGET integrated database retrieval system