KEGG   Vibrio vulnificus YJ016: VV2678Help
Entry
VV2678            CDS       T00150                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00240  Pyrimidine metabolism
vvy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VV2678
Enzymes [BR:vvy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VV2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: BAC95442
UniProt: Q7MI39
Position
I:complement(2715765..2717120)
Genome map
AA seq 451 aa AA seqDB search
MAHWAWEALMYLPQEIIRKKRDGEALTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEM
TMPERIALTCAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPM
ISGRGLGHTGGTLDKLEAIPGYNITPSNDVFGQVTKEAGVAIIGQTGDLAPADKRVYATR
DITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGA
GTKTTAILTDMNQVLASSAGNAVEVREAVRFLKGEYRNPRLLEVTMASCAEMLVLGKLAE
NTEDARAKLMEVLDNGKAAECFGKMVAGLGGPVDFMDNYDNYLDKAEIIKPVYAKETGVV
SAMDTRAIGMAVVAMGGGRRVATDSIDYAVGFDQFIRLGEIASSEKPLAMIHARNEAQWQ
EAANALQAAIKVGGEYTPTPDVYRQIRQEDI
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcccattgggcttgggaggctctaatgtatttacctcaagaaattattcgtaaaaaa
cgcgacggcgaagcgctgactgccgacgaaattaacttttttatccaaggtgtggcgaac
aatacggtctctgaaggtcagattgccgcgtttgcaatgaccatctttttcaatgaaatg
acgatgcctgaacgtattgccctaacgtgtgcaatgcgagattctggcatggtgattgat
tggagccacatgaactttggtggcccaatcgttgataaacactctaccggcggtgtgggc
gatgtgacctctttaatgcttggccctatggtggcagcatgtggtggtttcgtgccgatg
atctcaggccgtggcttgggccatacaggcggtacgttagacaaactggaagcgattccg
ggctacaacatcacaccaagtaacgacgtattcggtcaagtgaccaaagaagcgggtgtg
gcgatcatcggccaaacgggcgaccttgcaccagcagacaaacgagtttatgccactcgt
gatattacggcgacggtggacaacatctcactgatcaccgcttccattctgtctaagaaa
ttggcggcaggccttgaatctttagtgatggatgtgaaagtcggttcgggcgcctttatg
ccgacttacgaagcttcagaagaattggcgaaatccattgtggcggtggcgaatggcgcg
ggcactaagacgacggcgattttgaccgacatgaaccaagtattggcttcttctgcgggt
aacgctgtcgaagttcgtgaagcggttcgtttcctcaagggtgaatatcgtaaccctcgt
ttgcttgaagtcacgatggcgtcatgtgctgaaatgttggtacttggtaaattggctgaa
aataccgaagacgcacgtgcgaaattgatggaagtactggataacggtaaagcggcagaa
tgctttggtaagatggtggcaggtttgggtggtccggttgactttatggacaactacgac
aactacctcgataaagctgaaatcattaagcctgtttacgccaaagagaccggcgtggtg
tctgcaatggatactcgcgctattggtatggctgtggtggcgatgggcggtggacgccgc
gttgcgacggacagcatcgattacgcggtaggttttgatcagtttatccgtttgggcgaa
atcgcaagcagcgaaaaaccactggcgatgattcacgctcgtaacgaagcgcagtggcaa
gaagctgcgaatgcactacaagcagcgattaaggtgggtggtgagtacacaccaacacca
gacgtatatcgtcaaattcgccaagaagatatttaa

DBGET integrated database retrieval system