KEGG   Vibrio vulnificus YJ016: VV2678Help
Entry
VV2678            CDS       T00150                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vvy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2715765..2717093)
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEALTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMPERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLEAIPGYNITPSNDVFGQVTKEAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLKGEYRNPRLLEVTMASCAEMLVLGKLAENTEDARAKL
MEVLDNGKAAECFGKMVAGLGGPVDFMDNYDNYLDKAEIIKPVYAKETGVVSAMDTRAIG
MAVVAMGGGRRVATDSIDYAVGFDQFIRLGEIASSEKPLAMIHARNEAQWQEAANALQAA
IKVGGEYTPTPDVYRQIRQEDI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttacctcaagaaattattcgtaaaaaacgcgacggcgaagcgctgactgccgac
gaaattaacttttttatccaaggtgtggcgaacaatacggtctctgaaggtcagattgcc
gcgtttgcaatgaccatctttttcaatgaaatgacgatgcctgaacgtattgccctaacg
tgtgcaatgcgagattctggcatggtgattgattggagccacatgaactttggtggccca
atcgttgataaacactctaccggcggtgtgggcgatgtgacctctttaatgcttggccct
atggtggcagcatgtggtggtttcgtgccgatgatctcaggccgtggcttgggccataca
ggcggtacgttagacaaactggaagcgattccgggctacaacatcacaccaagtaacgac
gtattcggtcaagtgaccaaagaagcgggtgtggcgatcatcggccaaacgggcgacctt
gcaccagcagacaaacgagtttatgccactcgtgatattacggcgacggtggacaacatc
tcactgatcaccgcttccattctgtctaagaaattggcggcaggccttgaatctttagtg
atggatgtgaaagtcggttcgggcgcctttatgccgacttacgaagcttcagaagaattg
gcgaaatccattgtggcggtggcgaatggcgcgggcactaagacgacggcgattttgacc
gacatgaaccaagtattggcttcttctgcgggtaacgctgtcgaagttcgtgaagcggtt
cgtttcctcaagggtgaatatcgtaaccctcgtttgcttgaagtcacgatggcgtcatgt
gctgaaatgttggtacttggtaaattggctgaaaataccgaagacgcacgtgcgaaattg
atggaagtactggataacggtaaagcggcagaatgctttggtaagatggtggcaggtttg
ggtggtccggttgactttatggacaactacgacaactacctcgataaagctgaaatcatt
aagcctgtttacgccaaagagaccggcgtggtgtctgcaatggatactcgcgctattggt
atggctgtggtggcgatgggcggtggacgccgcgttgcgacggacagcatcgattacgcg
gtaggttttgatcagtttatccgtttgggcgaaatcgcaagcagcgaaaaaccactggcg
atgattcacgctcgtaacgaagcgcagtggcaagaagctgcgaatgcactacaagcagcg
attaaggtgggtggtgagtacacaccaacaccagacgtatatcgtcaaattcgccaagaa
gatatttaa

DBGET integrated database retrieval system