KEGG   Vibrio vulnificus YJ016: VV2762Help
Entry
VV2762            CDS       T00150                                 

Definition
7;8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vvy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2815835..2816320
Genome map
AA seq 161 aa AA seqDB search
MITAYIAIGSNLADPVSQAKSAINALKTLPKSRLLVASQLYSSSPMGPQDQPDYINAVAA
IETELTPLELLDCTQAIELEQGRVRKEERWGPRTLDLDIILYGDEVIDSERLTIPHYGMK
EREFVLYPLAEIAPNLTLPDGTELSQLLTIVDKNGLGIWHS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattactgcctatattgccattggcagtaatcttgccgatcctgttagccaagccaag
agcgccattaatgcactaaaaacgctgccaaaatcgcgcctacttgtcgcttcacagctc
tacagcagctccccgatgggcccgcaagatcagccagactacatcaatgcggtcgctgcc
atagaaaccgaattaacgccgttggaactgctcgattgcactcaagctattgaactggaa
caagggcgtgtccgtaaagaagaacgttggggcccaagaaccctcgatttagatattatt
ctttacggcgatgaggtgatcgactccgagcgattgaccattcctcactacggaatgaag
gagcgcgaattcgtgctctacccgctcgctgaaatcgcaccaaatttaaccctccctgat
gggaccgagctatctcaacttctcacaatagtggataagaatggcctcggcatttggcat
tcatag

DBGET integrated database retrieval system