KEGG   Vibrio vulnificus YJ016: VV2762Help
Entry
VV2762            CDS       T00150                                 

Definition
7;8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VV2762
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VV2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2815835..2816320
Genome map
AA seq 161 aa AA seqDB search
MITAYIAIGSNLADPVSQAKSAINALKTLPKSRLLVASQLYSSSPMGPQDQPDYINAVAA
IETELTPLELLDCTQAIELEQGRVRKEERWGPRTLDLDIILYGDEVIDSERLTIPHYGMK
EREFVLYPLAEIAPNLTLPDGTELSQLLTIVDKNGLGIWHS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattactgcctatattgccattggcagtaatcttgccgatcctgttagccaagccaag
agcgccattaatgcactaaaaacgctgccaaaatcgcgcctacttgtcgcttcacagctc
tacagcagctccccgatgggcccgcaagatcagccagactacatcaatgcggtcgctgcc
atagaaaccgaattaacgccgttggaactgctcgattgcactcaagctattgaactggaa
caagggcgtgtccgtaaagaagaacgttggggcccaagaaccctcgatttagatattatt
ctttacggcgatgaggtgatcgactccgagcgattgaccattcctcactacggaatgaag
gagcgcgaattcgtgctctacccgctcgctgaaatcgcaccaaatttaaccctccctgat
gggaccgagctatctcaacttctcacaatagtggataagaatggcctcggcatttggcat
tcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system