KEGG   Vibrio vulnificus YJ016: VV2908Help
Entry
VV2908            CDS       T00150                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00230  Purine metabolism
vvy00240  Pyrimidine metabolism
vvy01100  Metabolic pathways
vvy03030  DNA replication
vvy03430  Mismatch repair
vvy03440  Homologous recombination
Module
vvy_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VV2908
   00240 Pyrimidine metabolism
    VV2908
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VV2908
   03430 Mismatch repair
    VV2908
   03440 Homologous recombination
    VV2908
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VV2908
DNA replication proteins [BR:vvy03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VV2908
DNA repair and recombination proteins [BR:vvy03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     VV2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi GlgS
Motif
Other DBs
NCBI-ProteinID: BAC95673
UniProt: Q7MHG2
Position
I:2968406..2968855
Genome map
AA seq 149 aa AA seqDB search
MQRATFYIVREHTPQATPEGFAHYVVFLAHHFAKQGAKVYLNGESKRHAEQIAEYFWQVE
PAQFVAHNLVGEGPKYATNIEIGHEGVKPSWNRQLVINLAKNETTFANKFAEVVDFVPCE
EKAKQLARERYKIYRQAGYQLQTIEIEHN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagccacgttttacattgtccgagaacacaccccacaagcaacgccagaaggt
tttgctcactacgtagtgttccttgcccaccattttgccaagcaaggggcgaaggtgtat
ctcaatggagaaagtaaacgtcacgcagagcaaattgcagagtacttttggcaagttgag
cccgctcagtttgttgcgcataatttggtcggtgaaggtccaaaatacgccaccaacatt
gagataggtcacgaaggtgtcaagccaagctggaaccgccaactggtaataaatttggcg
aaaaatgagacaacctttgcgaacaagtttgctgaggtggtagacttcgtcccttgcgaa
gaaaaagctaaacagctcgcgcgagaaaggtataaaatctaccgtcaagcaggttaccaa
ctgcaaacaatcgaaattgaacacaactag

DBGET integrated database retrieval system