KEGG   Vibrio vulnificus YJ016: VV2908Help
Entry
VV2908            CDS       T00150                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vvy00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vvy00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:vvy03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:vvy03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vvy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2968406..2968855
Genome map
AA seq 149 aa AA seqDB search
MQRATFYIVREHTPQATPEGFAHYVVFLAHHFAKQGAKVYLNGESKRHAEQIAEYFWQVE
PAQFVAHNLVGEGPKYATNIEIGHEGVKPSWNRQLVINLAKNETTFANKFAEVVDFVPCE
EKAKQLARERYKIYRQAGYQLQTIEIEHN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagccacgttttacattgtccgagaacacaccccacaagcaacgccagaaggt
tttgctcactacgtagtgttccttgcccaccattttgccaagcaaggggcgaaggtgtat
ctcaatggagaaagtaaacgtcacgcagagcaaattgcagagtacttttggcaagttgag
cccgctcagtttgttgcgcataatttggtcggtgaaggtccaaaatacgccaccaacatt
gagataggtcacgaaggtgtcaagccaagctggaaccgccaactggtaataaatttggcg
aaaaatgagacaacctttgcgaacaagtttgctgaggtggtagacttcgtcccttgcgaa
gaaaaagctaaacagctcgcgcgagaaaggtataaaatctaccgtcaagcaggttaccaa
ctgcaaacaatcgaaattgaacacaactag

DBGET integrated database retrieval system