KEGG   Vibrio vulnificus YJ016: VV2955Help
Entry
VV2955            CDS       T00150                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00040  Pentose and glucuronate interconversions
vvy00052  Galactose metabolism
vvy00500  Starch and sucrose metabolism
vvy00520  Amino sugar and nucleotide sugar metabolism
vvy01100  Metabolic pathways
vvy01130  Biosynthesis of antibiotics
Module
vvy_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VV2955
   00052 Galactose metabolism
    VV2955
   00500 Starch and sucrose metabolism
    VV2955
   00520 Amino sugar and nucleotide sugar metabolism
    VV2955
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VV2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: BAC95719
UniProt: Q7MHB6
Position
I:3020714..3021586
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMDGMCIVTGRGKH
SIMDHFDKNYELEHQISGTNKEALLEDVRALIDSANFTYIRQREMKGLGHAILTGRELVG
DQPFAVVLADDLCVNEEQGVLAQMVALFKQFRCSIVAVQEVPENETHKYGVISGEMIKDD
LFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGRRFDCGSVEGYIEATNYCYQNLYLKDEKTSELGKFSTQKEK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgccttttccctgccgctggctacggcactcgcttcttacctgcgacc
aaatcgatgccaaaagaaatgatgccagtggtgaacaaacctctgatcgaatacggtgtg
gaggaagccatccaagcgggcatggacggaatgtgcattgttactggtcgtggtaagcat
tcaatcatggatcacttcgataaaaactacgaactagaacatcagattagtggtaccaac
aaagaagccctattggaagatgtacgtgctttgatcgactccgcgaactttacctacatt
cgccagcgtgagatgaagggcttagggcacgccatcttaacgggccgtgaactcgttggg
gatcaaccttttgccgtcgtactggctgatgacctttgtgtcaatgaagaacaaggtgtc
ttggcacaaatggtcgcgttgtttaagcagttccgctgttcgatcgttgctgttcaggaa
gtacctgaaaatgaaactcataaatacggcgttatctctggcgaaatgatcaaagacgat
ctcttccgcgtagacaacatggtggagaagccagaacctggtaccgcgccaagtaatctt
gcaattattggtcgttacattcttaccccagatatttttgatctgattgagcaaactgaa
ccaggtaaaggcggggaaattcaaatcaccgacgcactactcaaacaagcaaaagcaggt
tgtgtattggcatataagtttaaaggtcgtcgttttgattgcggcagcgttgaaggctat
atcgaagcaaccaactattgctaccaaaacctttatctgaaagatgagaagacgtctgaa
ttgggcaaattcagtacgcaaaaagagaagtaa

DBGET integrated database retrieval system