KEGG   Vibrio vulnificus YJ016: VV2955Help
Entry
VV2955            CDS       T00150                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VV2955
   00052 Galactose metabolism
    VV2955
   00500 Starch and sucrose metabolism
    VV2955
   00520 Amino sugar and nucleotide sugar metabolism
    VV2955
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VV2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3020714..3021586
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMDGMCIVTGRGKH
SIMDHFDKNYELEHQISGTNKEALLEDVRALIDSANFTYIRQREMKGLGHAILTGRELVG
DQPFAVVLADDLCVNEEQGVLAQMVALFKQFRCSIVAVQEVPENETHKYGVISGEMIKDD
LFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGRRFDCGSVEGYIEATNYCYQNLYLKDEKTSELGKFSTQKEK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgccttttccctgccgctggctacggcactcgcttcttacctgcgacc
aaatcgatgccaaaagaaatgatgccagtggtgaacaaacctctgatcgaatacggtgtg
gaggaagccatccaagcgggcatggacggaatgtgcattgttactggtcgtggtaagcat
tcaatcatggatcacttcgataaaaactacgaactagaacatcagattagtggtaccaac
aaagaagccctattggaagatgtacgtgctttgatcgactccgcgaactttacctacatt
cgccagcgtgagatgaagggcttagggcacgccatcttaacgggccgtgaactcgttggg
gatcaaccttttgccgtcgtactggctgatgacctttgtgtcaatgaagaacaaggtgtc
ttggcacaaatggtcgcgttgtttaagcagttccgctgttcgatcgttgctgttcaggaa
gtacctgaaaatgaaactcataaatacggcgttatctctggcgaaatgatcaaagacgat
ctcttccgcgtagacaacatggtggagaagccagaacctggtaccgcgccaagtaatctt
gcaattattggtcgttacattcttaccccagatatttttgatctgattgagcaaactgaa
ccaggtaaaggcggggaaattcaaatcaccgacgcactactcaaacaagcaaaagcaggt
tgtgtattggcatataagtttaaaggtcgtcgttttgattgcggcagcgttgaaggctat
atcgaagcaaccaactattgctaccaaaacctttatctgaaagatgagaagacgtctgaa
ttgggcaaattcagtacgcaaaaagagaagtaa

DBGET integrated database retrieval system