KEGG   Vibrio vulnificus YJ016: VV3025Help
Entry
VV3025            CDS       T00150                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV3025 (tpiA)
   01230 Biosynthesis of amino acids
    VV3025 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV3025 (tpiA)
   00051 Fructose and mannose metabolism
    VV3025 (tpiA)
   00562 Inositol phosphate metabolism
    VV3025 (tpiA)
Enzymes [BR:vvy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VV3025 (tpiA)
Exosome [BR:vvy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VV3025 (tpiA)
  Exosomal proteins of bladder cancer cells
   VV3025 (tpiA)
  Exosomal proteins of melanoma cells
   VV3025 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3104777..3105547
Genome map
AA seq 256 aa AA seqDB search
MRRPVVMGNWKLNGSKTMVAELLTGLNAELEGVEGVDVAVAPPALYIDLAERLIAEGGNK
IILGAQNTDINNSGAFTGDMSPAMLKDFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLKPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHASIRAMIAAKDAAVAEQVIIQYGGSVKPENAEAYFAQPDIDGALVGGASLD
AKSFAAIAKAAAKMKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtagtgatgggtaactggaaacttaacggcagcaaaactatggttgct
gaactgctaactggtctaaacgctgaactagaaggcgttgaaggtgtagacgtagcggta
gcgccgccagcactttacatcgaccttgcagagcgcctaatcgctgaaggtggcaacaag
atcattcttggtgcacaaaacactgacatcaacaacagcggtgcattcactggcgacatg
tctcctgcaatgctaaaagactttggtgctactcacatcattattggtcactctgagcgt
cgtgaataccacaatgaatcagatgagttcgtagcgaagaagtttgcattcctgaaagaa
aatggtctaaaaccagttttctgtatcggtgaaactgaagcgcaaaacgaagcaggcgaa
actgaagccgtttgtgcacgtcaaatcaacgcagtgatcgacgcatacggtgttgaagcg
ctaaacggtgccatcatcgcttacgaaccaatctgggcgatcggtacaggtaaagctgca
acagcagaagatgcacagcgtatccacgcctctatccgtgcgatgatcgcagcaaaagat
gctgcagtagcagagcaagtgatcatccaatacggtggttctgttaaaccagaaaacgca
gaagcttacttcgcacaaccagacatcgatggtgctcttgttggtggtgcatctctagac
gctaagagcttcgcagcgatcgcgaaagcagcagcgaaaatgaaagcgtaa

DBGET integrated database retrieval system