KEGG   Vibrio vulnificus YJ016: VV3110Help
Entry
VV3110            CDS       T00150                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00010  Glycolysis / Gluconeogenesis
vvy00030  Pentose phosphate pathway
vvy00051  Fructose and mannose metabolism
vvy00052  Galactose metabolism
vvy00680  Methane metabolism
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy01130  Biosynthesis of antibiotics
vvy01200  Carbon metabolism
vvy01230  Biosynthesis of amino acids
vvy03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV3110
   00030 Pentose phosphate pathway
    VV3110
   00051 Fructose and mannose metabolism
    VV3110
   00052 Galactose metabolism
    VV3110
  Energy metabolism
   00680 Methane metabolism
    VV3110
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VV3110
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VV3110
Protein phosphatases and associated proteins [BR:vvy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VV3110
Messenger RNA biogenesis [BR:vvy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VV3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: BAC95874
UniProt: Q7MGW6
Position
I:complement(3190492..3191460)
Genome map
AA seq 322 aa AA seqDB search
MSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGLYEGRIKQLDRSSV
SDVINRGGTFLGSARFPEFKEVAVREKAIENLKAHGIDALVVIGGDGSYMGAKKLTEMGY
PCIGLPGTIDNDIAGTDYTIGYLTALNTVIESIDRLRDTSSSHQRISIVEIMGRHCGDLT
LMSAIAGGCEYIITPETGLDKEKLIGNIQDGISKGKKHAIIALTELMMDANELAKEIEAG
TGRETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDII
DAIENMKRPVRNDLFKVAEELF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgattaagaagatcggtgttttgacaagtggtggtgacgcccctggtatgaac
gcagcaatccgtggtgtggtacgtactgcactgggtgctggtcttgaagtttatggtatc
tatgatggctacctaggcttgtacgaaggccgtattaaacaacttgatcgttcaagcgtt
tctgatgtgattaaccgtggtggtacattcttgggatcagctcgtttcccagaatttaaa
gaagttgcggtacgtgaaaaagcgattgaaaacctaaaagcacacggtattgacgcgctt
gtggttatcggcggcgacggttcgtacatgggtgcgaagaaactgactgaaatgggttac
ccatgtatcggtctaccaggcacgattgacaacgatatcgcaggtacggattacaccatc
ggttacctaacggcgctgaacacggttatcgaatcgatcgaccgtctacgcgatacttca
tcttctcaccagcgtatttctatcgtagaaatcatgggtcgtcactgtggtgacctcact
ctgatgtctgctatcgcaggtggctgtgaatacatcatcacaccagaaactggcctagat
aaagagaagctgattggcaacatccaagacggcatttctaaaggtaagaaacatgcgatc
atcgcgctgactgagctgatgatggacgcgaacgaactggcaaaagagatcgaagcggga
acgggtcgtgaaactcgtgccacggttcttggtcacatccaacgtggtggccgtccaacg
gcgttcgaccgtgttcttgcgtctcgtatgggtaactacgcggttcacctattgatggaa
ggtcatggtggccgttgtgttggtatcgtgaaagagcaacttgttcaccacgacatcatc
gatgcaatcgagaacatgaagcgtccagttcgcaatgatctgttcaaagtagcagaagag
ctattctaa

DBGET integrated database retrieval system