KEGG   Vibrio vulnificus YJ016: VV3110Help
Entry
VV3110            CDS       T00150                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VV3110 (pfkA)
   01230 Biosynthesis of amino acids
    VV3110 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV3110 (pfkA)
   00030 Pentose phosphate pathway
    VV3110 (pfkA)
   00051 Fructose and mannose metabolism
    VV3110 (pfkA)
   00052 Galactose metabolism
    VV3110 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VV3110 (pfkA)
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VV3110 (pfkA)
Protein phosphatases and associated proteins [BR:vvy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VV3110 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3190492..3191460)
Genome map
AA seq 322 aa AA seqDB search
MSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGLYEGRIKQLDRSSV
SDVINRGGTFLGSARFPEFKEVAVREKAIENLKAHGIDALVVIGGDGSYMGAKKLTEMGY
PCIGLPGTIDNDIAGTDYTIGYLTALNTVIESIDRLRDTSSSHQRISIVEIMGRHCGDLT
LMSAIAGGCEYIITPETGLDKEKLIGNIQDGISKGKKHAIIALTELMMDANELAKEIEAG
TGRETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDII
DAIENMKRPVRNDLFKVAEELF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgattaagaagatcggtgttttgacaagtggtggtgacgcccctggtatgaac
gcagcaatccgtggtgtggtacgtactgcactgggtgctggtcttgaagtttatggtatc
tatgatggctacctaggcttgtacgaaggccgtattaaacaacttgatcgttcaagcgtt
tctgatgtgattaaccgtggtggtacattcttgggatcagctcgtttcccagaatttaaa
gaagttgcggtacgtgaaaaagcgattgaaaacctaaaagcacacggtattgacgcgctt
gtggttatcggcggcgacggttcgtacatgggtgcgaagaaactgactgaaatgggttac
ccatgtatcggtctaccaggcacgattgacaacgatatcgcaggtacggattacaccatc
ggttacctaacggcgctgaacacggttatcgaatcgatcgaccgtctacgcgatacttca
tcttctcaccagcgtatttctatcgtagaaatcatgggtcgtcactgtggtgacctcact
ctgatgtctgctatcgcaggtggctgtgaatacatcatcacaccagaaactggcctagat
aaagagaagctgattggcaacatccaagacggcatttctaaaggtaagaaacatgcgatc
atcgcgctgactgagctgatgatggacgcgaacgaactggcaaaagagatcgaagcggga
acgggtcgtgaaactcgtgccacggttcttggtcacatccaacgtggtggccgtccaacg
gcgttcgaccgtgttcttgcgtctcgtatgggtaactacgcggttcacctattgatggaa
ggtcatggtggccgttgtgttggtatcgtgaaagagcaacttgttcaccacgacatcatc
gatgcaatcgagaacatgaagcgtccagttcgcaatgatctgttcaaagtagcagaagag
ctattctaa

DBGET integrated database retrieval system