KEGG   Vibrio vulnificus YJ016: VV3133Help
Entry
VV3133            CDS       T00150                                 

Definition
(GenBank) acetyl-CoA synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00010  Glycolysis / Gluconeogenesis
vvy00620  Pyruvate metabolism
vvy00640  Propanoate metabolism
vvy00680  Methane metabolism
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy01130  Biosynthesis of antibiotics
vvy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV3133
   00620 Pyruvate metabolism
    VV3133
   00640 Propanoate metabolism
    VV3133
  Energy metabolism
   00680 Methane metabolism
    VV3133
Enzymes [BR:vvy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VV3133
Lipid biosynthesis proteins [BR:vvy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VV3133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAC95897
UniProt: Q7MGU3
Position
I:3215890..3217902
Genome map
AA seq 670 aa AA seqDB search
MTVLNVMELHHEDKGTRRETMSEAHIYPVKENIKAHTHADNDTYLAMYQQSVTDPEGFWS
EHGKIVDWIKPFTKVKQTSFDTGHVDIRWFEDGTLNVSANCIDRHLAERGDDVAIIWEGD
NPADDKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHT
IVFGGFSPEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVVVF
KRTGGNIDWHEHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGG
YLVYATMTFKYVFDYQPGETFWCTADVGWITGHTYLVYGPLANGAKTILFEGVPNYPNTS
RMSEVVDKHQVNILYTAPTAIRALMAKGNEAIEGTDRSSLRIMGSVGEPINPEAWEWYYK
TIGNEKSPIVDTWWQTETGGILITPLPGATALKPGSATRPFFGVQPALVDNMGNVIEDQA
AEGNLVILDSWPGQMRTVYGDHERFEQTYFSTFKGMYFTGDGARRDEDGYYWITGRVDDV
LNVSGHRMGTAEIESALVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAGEYPTAELHKEV
KDWVRKEIGPIATPDVLHWTDALPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVD
KLIAEKAELV
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgactgttttaaacgtcatggaactccatcacgaagacaaaggcacaaggagagagaca
atgagtgaagcccacatttatccggtaaaagagaacatcaaagcccatacccatgcggat
aatgatacctacctagccatgtaccagcagtcagtcactgacccagaaggtttctggagt
gaacacggcaaaattgttgactggattaagcccttcaccaaagtcaaacaaacgtctttt
gatactggccacgttgatattcgctggtttgaagatggcacgctcaacgtctcagcaaac
tgtattgaccgccatctagcagagcgcggcgatgatgtcgccatcatttgggaaggcgac
aacccagcggacgacaaaactctgacttacaacgagctctacaccgaagtgtgtcgtttc
tcgaatgcactcaaagagcaaggcgtacgcaaaggcgacgtggtgtgtctctacatgcca
atggtccctgaagcggcggttgcgatgttggcctgtacccgtattggtgcggtgcacacc
atcgtctttggtggtttttcaccagaagcactggctggccgcatcatcgactccgatgcc
aaagtcgtcatcacggccgacgaaggcgttcgtggtggtcgcgcggtgccactgaaaaag
aacgtggacgaagcactaaccaacccagaagtgaaaaccatcagcaaagtggtggtgttc
aagcgcactggcggcaacattgattggcacgaacatcgtgatgtttggtggcacgaagcg
acagcaaaagtctctgacgtttgcccaccagaagagatgaaagctgaagatccgctgttc
atcctctacacgtcaggctcaaccggcaaaccgaaaggcgtgctgcacaccacgggcggc
tatttggtctacgcgaccatgacctttaagtacgtgtttgactaccagccaggcgaaact
ttctggtgtacggccgacgtgggttggatcactggccacacgtatctggtttacggtcca
ctggcaaacggcgcgaaaaccattctctttgaaggcgtgccaaactatccaaacaccagc
cgcatgagtgaagtggtcgataagcaccaagtcaacattctttacaccgcaccaacggcc
attcgtgcgctgatggcaaaaggcaacgaagcgattgaaggtacggatcgtagcagccta
cgcatcatgggctctgtgggtgaacctattaacccagaggcgtgggagtggtactacaag
accatcggcaacgagaaatcaccgattgtcgatacttggtggcaaaccgaaaccggcggc
attttgatcacaccactgccaggcgccaccgcgctgaaaccgggttctgcaacgcgccca
ttctttggtgttcagcctgcactggtggacaacatgggtaatgtgatcgaagaccaagcc
gcagaaggtaacctcgttatcctcgattcttggccaggtcaaatgcgcacggtttatggt
gaccatgaacgtttcgaacaaacctacttctcaacctttaaaggcatgtactttaccgga
gatggtgcgcgccgcgatgaagatggttactactggatcacaggccgtgtggatgacgta
ttaaacgtttctggccaccgtatgggtacagcggaaattgaatccgccctagtggcacac
ccgaaaattgctgaagcggcgattgttggcattccacacgacatcaaaggccaagcaatt
tacgcctatgtcaccctcaatgcgggcgagtatccaaccgccgagctgcataaagaagtg
aaagattgggtacgtaaagagattggccccatcgcaacaccagatgtcctgcattggaca
gatgcactaccgaaaactcgttcaggtaaaatcatgcgccgcattttgcgcaagatcgcc
acgggagacaccagcaacttgggtgacacctcaacactggccgacccaagcgtagttgat
aagctgatcgcagaaaaagccgaactggtttaa

DBGET integrated database retrieval system