KEGG   Vibrio vulnificus YJ016: VV3205Help
Entry
VV3205            CDS       T00150                                 

Definition
thiamine biosynthesis protein ThiF
Orthology
K03148  
sulfur carrier protein ThiS adenylyltransferase [EC:2.7.7.73]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:vvy00730]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:vvy04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3292007..3292855)
Genome map
AA seq 282 aa AA seqDB search
MRPIMLVDRLFTRYQRQIALTEFGESGQANLLQAHVLIIGCGGLGNAAALYLAAAGVGHL
VLVDDDVVEESNLQRQIAFRQQHLASPKVDALAEQLKQLNAELRVRTISQRLDEERLNLE
VMLADIVLDCTDNFPSRQLINQACLNQRTPLVSASAIGWKGQFIAFDFSSYHSIQSQQDT
SSAASSVNPPCYHCLFPFAENAMQTKCSDAGVIGPVVGLMGNYQAIATIQKLATGAFQTT
CHQLHLFDGLKLSWQHLAVVKDPSCRVCQIQKQESSNEHHSN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccaatcatgttggttgatcggctctttactcgttatcaaagacaaattgcatta
acggaatttggtgagtcagggcaagccaacttacttcaagcacatgtgctgatcatcggt
tgcggtggtcttggtaacgcagcggcgctttatttggctgctgcgggcgttggccattta
gtgttggtggatgatgatgtggttgaagagagtaacttgcagcgtcaaattgcgtttcgt
cagcaacatctcgccagccccaaagtggatgcactcgcagagcaattgaagcagctcaat
gcagaattgcgcgttcgcaccattagccaacgtttggatgaagaacgtctcaacttggaa
gtgatgttggcggacattgtgctcgattgtacggacaactttccatcgcgccaactgatc
aaccaagcctgcctgaatcaacgtaccccattagtgtcggcctcggcaattggctggaaa
gggcaattcattgcgtttgattttagctcataccactcaatccaatcccagcaagatacc
tcgtcggccgcgagttcagtaaaccctccgtgctaccactgcctattcccatttgcagaa
aatgccatgcagaccaagtgcagtgatgctggggtgattggccctgtcgtggggctaatg
ggaaattatcaggcaatcgcaacgattcaaaagctggcaacgggcgcgtttcaaaccact
tgccatcagttgcatctgtttgatgggctcaagttaagttggcagcatttggcagtagtg
aaagatccaagttgccgcgtttgtcagattcagaaacaggaatcaagcaatgaacaccat
agcaattag

DBGET integrated database retrieval system