KEGG   Vibrio vulnificus YJ016: VV3205Help
Entry
VV3205            CDS       T00150                                 

Definition
thiamine biosynthesis protein ThiF
Orthology
K03148  
sulfur carrier protein ThiS adenylyltransferase [EC:2.7.7.73]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    VV3205
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    VV3205
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.73  sulfur carrier protein ThiS adenylyltransferase
     VV3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3292007..3292855)
Genome map
AA seq 282 aa AA seqDB search
MRPIMLVDRLFTRYQRQIALTEFGESGQANLLQAHVLIIGCGGLGNAAALYLAAAGVGHL
VLVDDDVVEESNLQRQIAFRQQHLASPKVDALAEQLKQLNAELRVRTISQRLDEERLNLE
VMLADIVLDCTDNFPSRQLINQACLNQRTPLVSASAIGWKGQFIAFDFSSYHSIQSQQDT
SSAASSVNPPCYHCLFPFAENAMQTKCSDAGVIGPVVGLMGNYQAIATIQKLATGAFQTT
CHQLHLFDGLKLSWQHLAVVKDPSCRVCQIQKQESSNEHHSN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccaatcatgttggttgatcggctctttactcgttatcaaagacaaattgcatta
acggaatttggtgagtcagggcaagccaacttacttcaagcacatgtgctgatcatcggt
tgcggtggtcttggtaacgcagcggcgctttatttggctgctgcgggcgttggccattta
gtgttggtggatgatgatgtggttgaagagagtaacttgcagcgtcaaattgcgtttcgt
cagcaacatctcgccagccccaaagtggatgcactcgcagagcaattgaagcagctcaat
gcagaattgcgcgttcgcaccattagccaacgtttggatgaagaacgtctcaacttggaa
gtgatgttggcggacattgtgctcgattgtacggacaactttccatcgcgccaactgatc
aaccaagcctgcctgaatcaacgtaccccattagtgtcggcctcggcaattggctggaaa
gggcaattcattgcgtttgattttagctcataccactcaatccaatcccagcaagatacc
tcgtcggccgcgagttcagtaaaccctccgtgctaccactgcctattcccatttgcagaa
aatgccatgcagaccaagtgcagtgatgctggggtgattggccctgtcgtggggctaatg
ggaaattatcaggcaatcgcaacgattcaaaagctggcaacgggcgcgtttcaaaccact
tgccatcagttgcatctgtttgatgggctcaagttaagttggcagcatttggcagtagtg
aaagatccaagttgccgcgtttgtcagattcagaaacaggaatcaagcaatgaacaccat
agcaattag

DBGET integrated database retrieval system