KEGG   Vibrio vulnificus YJ016: VVA0078Help
Entry
VVA0078           CDS       T00150                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VVA0078 (malQ)
Enzymes [BR:vvy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VVA0078 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:85188..87368
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVAEMARLADSYVSAWGDEALVSEETLRRLLNSLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGDPVEVELNLGTSARESEFNWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKDLAWGYHKLYVSRKRRKAPYEMALIITPRACFKQDSLELNKKLWGPSIQLY
TLRTQHNWGIGDFGDLKLLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
LYIDVSSVPEFALSAEAQQKVGSAEFQQRLQKARESHWVNYTEVAELKMSVLPLLFAEFK
TRHLDKNSDRARAFLEFVEEGGDSLVHQAAFDALHAELHAQDSNVWGWPVFPEQYRRFDS
AATQKFIKDNQEKVHLYMYLQWIADGQIKEAQALAEEKGMSVGLYRDLAVGVADSGSETW
ADNGNLVLDASIGAPPDILGPLGQNWGLPPLNPEVLQATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYADQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPNEEQLNGLFDDRLKCKQGILDSVRWHGYLPEGIGHDAQYVPMDAHLSEALQLHVA
AGASALLSVQLEDWLQMDNPVNIPGTVDEYPNWRRKLSMNLEEIFSREDVNRIARRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcattaaagaaagtcgcagaaatggcacgattagctgacagctat
gtcagcgcttggggagacgaagcattggtctccgaagaaacgctacgccgcctgctcaac
tctcttggctatgacactagcagcgatgaaaaactactggcttcagctgagaaaaaacac
aagaaagacgtattagcgccagtattggtattgcgtgatggcgatccggtggaagtggaa
ctgaatcttggcaccagtgcgcgtgaaagcgagttcaattggcgtttagaaacagaacaa
ggagaggtactggaaggctatcttcagtcacagattgttcgcgatgaacgtgccgagggt
ggccctctagtgtttgccctgccaaaagatttggcttggggttatcacaaactatacgtg
agccgtaagcgtcgtaaagcaccgtatgaaatggcgttgatcatcacgccacgcgcttgt
ttcaaacaagattctctagagttgaacaaaaagctctggggcccaagtattcagctttac
accctacgcacccagcacaactggggtatcggtgattttggcgatcttaaattgctggtg
agtgacatcgcatctcgtggtggtgatttcatcggtctgaacccgatccactcgctattt
cctgccaacccagaaggcgctagcccatacagcccatcgtctcgccgttggttgaacatt
ctttatatcgatgtgagctctgttcctgagtttgcgctcagtgcggaagcgcaacagaaa
gttggcagcgccgaattccagcagcgcctgcaaaaagcgcgtgaatcacattgggtgaac
tacaccgaagtggcagagctgaaaatgagcgtattgccactgctgtttgcggagttcaaa
actcgtcatctcgacaaaaacagcgatcgtgctcgcgcgttcctagagtttgtggaagaa
ggcggtgacagcctcgtgcaccaagcggcgttcgatgcattgcacgcagagctacacgcg
caagattcaaacgtgtggggctggccagttttccctgagcaataccgccgctttgattct
gccgcgacgcagaaattcatcaaagacaaccaagaaaaagtgcacctttacatgtacttg
cagtggattgctgacggccagatcaaagaagcgcaagcgctggctgaagagaaaggcatg
tccgttggtctctaccgtgaccttgcagtcggtgtggccgattctggcagcgaaacatgg
gcagataacggcaacctagtactggatgccagcatcggtgcgccaccggatatccttggt
ccactgggccaaaactggggtctgccaccactcaaccctgaagtgctgcaagccactggt
tatgacgcgtacatcaaactgctgcgtgccaacatgaaacattgtggcgcactgcgtatt
gaccacgtacttggccttcttcgcctatggtggattccaaaaggcgaaaaagcgacagaa
ggggcgtacctctactacccagtcgaagacatgctagcgattttggcgttggaatctcac
cgtcatcagtgcagcgtgatcggtgaagacttgggtacggtgccagatgaaatcgttgat
atcctgcgtgatgcgggcgtgcactcgtacaaagtgttcttcttcgaaacatcaaaagaa
gatggcggtttcatttcgccaaaacactatgccgatcagtcgatggcggccttgtgtacc
cacgatatgccaacgcttcgcggcttctggcattgcgatgacctcaaaatggggcgtgaa
attggcctctatccaaacgaagagcagctcaatggcttgttcgacgatcgcctaaaatgc
aagcaaggcattttggatagcgtgcgttggcatggttacttgccagaaggcattggccac
gatgcgcaatacgtgccaatggatgcgcacttaagtgaagcattgcagttgcatgtagca
gcgggcgcttccgcgctgctcagtgttcagcttgaagactggttgcaaatggacaaccca
gtcaacatcccgggcacggtcgatgagtacccgaactggcgtcgtaaattgtcgatgaac
cttgaagagattttcagccgtgaggatgtgaatcgaatcgctcgtcgtctcaccgaagtg
cgcgcacaagcgagcaaataa

DBGET integrated database retrieval system