KEGG   Vibrio vulnificus YJ016: VVA0079Help
Entry
VVA0079           CDS       T00150                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VVA0079
Enzymes [BR:vvy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VVA0079
Exosome [BR:vvy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VVA0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:87555..89783
Genome map
AA seq 742 aa AA seqDB search
MRIVFTTLAVWRGKKGLKKLVKSKVNQMFEKLSQAACSEPFAFLGPFIDPTQGALRVWMP
GATGVALVLEGQPRIALEREKESAFILKADLNLHLTHYQLAIDWNGIEQLVDDPYQYHGI
YAEYDDLHTPKTMYQHMGSQFMTLERDGKSISGIRFLVYAPHATAVSLVGSFNDWDGRRH
PMQRLDYGIWGLFIPGLTEGVSYKFEMKGPKGEGLPHKADPWGFYAEQYPSFASVTYDHA
RYQWQDAQWQTRPVTEKRKEALSFYELHAGSWKRNEQGEFLNYRELAAELVPYLVDMGYT
HVELMPVSEHPFYGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGIGVVLDWVPAHFP
SDDHGLANFDGTPLFHDPDPRRGWHQDWNSFIYDLGREQVRRFLVSNALYWFEQFHIDGI
RVDAVASMLYLDYSRSHGQWIPNMDGGNENYDAIATLKWMNEEVYKYFPNAMTIAEESTA
FPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIKEEPVHRKYHHNTLTFPLVYAHSENYVLS
LSHDEVVYGKGSIHNKMPGDEWQQTANLRAYFGYMYGQPGKKLNFMGAEIGQTAEWNHDD
QLQWFLLDFPRHQGVQALTRDLNHLYRNEAALHDQDCIPAGFEWRLQDAAEQSIIAHERI
SEAGERILVVSNFTPVPRDEFRLGVPNKGRYQLLLNTDDSKYAGSGYEVVVDVKSEAVVS
EDLAQSIVLRLPPLSTLFYKLA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgtgttcacaacgttggctgtttggcgagggaaaaaaggtttgaaaaaatta
gtaaaaagtaaagtgaatcagatgtttgagaaattgtctcaagccgcttgttcagagccg
tttgcatttttaggtccatttattgacccaacacaaggggcactgcgcgtctggatgccg
ggtgcaacgggggtggcattggtattagaaggccagccacgtattgcgcttgagcgagaa
aaagagagcgccttcattctcaaagccgatctcaatctgcatcttacccattatcaattg
gcgatcgattggaatggcatcgaacaacttgtcgatgacccataccaataccacggtatc
tacgccgagtatgacgatctccacacgccgaaaaccatgtatcaacacatgggctcacag
tttatgacgcttgagcgcgacggcaaatcaatctctggtatccgtttcttggtgtatgcg
ccgcatgcgaccgcagtgagtctcgtaggcagtttcaatgattgggatggccgacgtcat
ccaatgcagcgccttgattacggcatttggggtttattcattccagggttaaccgaaggg
gtgagctacaagttcgaaatgaaagggccgaagggggaaggcttaccacacaaagctgac
ccttggggtttctacgcagagcaatacccatcttttgcttccgtcacgtacgatcacgct
cgctaccaatggcaagatgcccaatggcaaactcgcccagtgaccgagaaacgcaaagaa
gcgctctctttctacgagttgcatgccggttcttggaagcgcaacgagcaaggtgagttc
ctgaattatcgcgaactggccgccgagttggtgccctatttggtggatatgggctacacc
catgttgaactgatgcctgtctctgagcacccgttctacggctcttggggttaccagcct
gtgggtctctttgcaccaaccagccgctatggttcacccgatgatttcaaattcttcgtc
gatgcgtgtcaccaagcgggcattggtgtggtattggattgggtgcctgcgcacttccca
tcggacgatcacggcttggccaattttgatggtacaccattgttccacgacccagaccca
cgccgtggttggcaccaagactggaactcgtttatctacgatcttggccgcgagcaagta
cgccgtttcttggtttctaatgcactgtattggtttgagcagttccatatcgatggtatt
cgggtggatgcggtggcatcgatgctgtatctcgattattcacgcagccatggccagtgg
atcccgaacatggatggcggcaacgaaaactacgatgcaattgccaccctaaaatggatg
aatgaggaagtgtataaatacttcccgaatgcgatgacgattgcggaagagtcgaccgct
ttcccgggcgtgtccgcaccgacctttatgggcgggttgggctttggctttaagtggaat
atggggtggatgcacgatagtctttcttacatcaaagaagagcctgttcatcgtaaatac
caccacaataccctcacgttcccgctcgtttacgctcacagtgagaactacgtcttgtcg
ctttctcacgatgaagtggtgtacggcaaaggttctattcacaacaaaatgccaggtgat
gagtggcagcaaaccgccaatttacgtgcgtattttggttacatgtatggtcaaccgggc
aaaaaactcaactttatgggcgcggaaatcggccaaacggcagagtggaatcacgatgac
caactgcaatggttcttgctcgatttcccacgtcaccaaggcgtgcaagccttgacgcgt
gatctcaaccacttgtatcgaaatgaagcggcgctgcacgatcaagattgcatcccagcc
ggttttgagtggcgtttacaagatgctgccgagcagagcattattgcgcacgagcgtatc
agtgaagcaggcgagcgcattctggtagtgagtaactttaccccagtgccacgtgatgaa
ttccgcttaggcgtgccaaacaaaggccgctaccaattgctgctcaacaccgacgacagc
aaatacgcaggcagcggctacgaggttgtagtagacgtcaagagcgaagcggtggtcagt
gaagatttggctcagtcgattgtgttgcgcctaccgccactgtcgaccctgttctataag
ctggcctaa

DBGET integrated database retrieval system