KEGG   Vibrio vulnificus YJ016: VVA0166Help
Entry
VVA0166           CDS       T00150                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vvy00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vvy00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vvy00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:193713..195833
Genome map
AA seq 706 aa AA seqDB search
MMTNKTVVELSGRETQLMVELGEYAEILHWGQKVSGDLSSFRMALHRPVPYGRLDTDVAM
TLHPELGRGVFSSPGVEGHREGQDWAPVFVISHVEHGQGSIVIQSEDAIAGLRLTTELML
DQHDVVKTRHTLTNIKAGLYQVNRLANTLPLPARANELMTYYGRWVHEFQTVRQPLLQGG
YQQENRRGRTSHEHYPALVAGSAHFDEMSGDVWGFHFAWSGNHRLRVDVKADGRRYMQAE
VIYLPGEVALKEGESLTTPWLYASYSRSGLNGMSHHFHSHVRDSILPEDFANKPRPIHLN
TWEGIYFDHDPDYIMSMATQSAEMGVERFIIDDGWFKGRNGDKAGLGDWFLCETKYPNGL
QPIVEHVNKLGMEFGLWFEPEMINKDSDLYRTHPDWLLAVEGYDQPTGRNQYVINLQNDD
AFNFLFERLDHFLSTYNIAYIKWDMNREVVQPSHLGQAAAHNQTQRYYQLVDKVREKHPN
VEIESCAAGGGRIDFEVLKRTHRFWASDNNDALERQTIQRGMSYFFPPEVMGSHIGASHC
HSTRRRHSIEFRGLTALFGHMGIELDPVKEEQVEKEGFERYIKLHKMLRPLLHSGRTWRI
PTDDKAHQIHAVVANDQSQAVVMIAQLAMPTNSLSGHLRVPGLDPQATYRVTVLDKPSNY
DDIVNYQPAWTESGCELSGAWCEEVGLTMPILDAESAMLVTFERIH
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaacaaaacagtggttgagttaagcggtcgggaaactcagttaatggtcgag
ctcggcgaatacgcggagattctgcactggggacaaaaagtaagtggtgaccttagtagt
ttccgcatggctttacatcgtcccgtgccatatggtcgccttgatactgatgtagcaatg
acactccatcctgagcttggccgcggtgtgttcagtagccccggtgtggaagggcatcgt
gaaggacaagattgggcacccgtgtttgtcatctcccatgttgaacacggccaaggttcg
atcgtgattcaaagcgaagatgcgatcgcaggccttcgcctgacaaccgagctgatgctg
gatcagcatgatgtggttaaaacgcgccacacactcaccaacattaaagcgggcctatac
caagtgaaccgcttggcgaacactttgcctttgcctgcccgtgcgaacgagttgatgacc
tattacgggcgctgggttcacgagtttcaaaccgtgcgtcaacctttgcttcaagggggc
taccaacaagagaaccgccgtggacgcacttcccatgaacattatccggcattggttgct
ggcagcgcgcattttgacgaaatgagtggcgatgtatgggggttccatttcgcatggagt
ggcaatcacagactgcgtgtggacgtgaaagctgacggtcgccgttatatgcaagcggag
gtgatctatcttccaggtgaagtggcactgaaagagggcgaaagcctgaccacgccgtgg
ttgtacgcaagttacagccgctcgggtctcaacggcatgagccaccatttccactcacac
gtccgtgattcgattttgcctgaggattttgcgaacaagcctcgtccgattcaccttaat
acttgggaaggcatctacttcgatcacgatccagactacatcatgtcaatggcaacccaa
tcggcggagatgggcgttgaacgctttattattgatgacggctggttcaaagggcgcaat
ggcgacaaagccgggctaggggactggttcttatgtgaaaccaagtatccgaatggtttg
caaccgatcgtcgaacacgtcaacaaactgggtatggagtttggtttgtggttcgaacca
gagatgatcaacaaagattcagatttgtatcgcacgcatcctgattggttattggccgtt
gagggttacgaccagccaaccggtcgcaaccagtatgtgattaacctgcaaaacgacgat
gcgtttaacttcctgtttgagcggttggaccatttcctctcgacttacaacatcgcttac
atcaaatgggacatgaaccgtgaagtggtgcagccatcgcatttaggccaagcggcagcg
cacaatcaaacccaacgttactaccagttagtcgataaagttcgcgaaaagcatccaaac
gtcgagattgaatcttgcgcggcgggcggtggccgtatcgattttgaggtactgaaacgt
acgcatcgattctgggcgtcagacaacaatgacgcacttgagcgtcaaaccattcaacgc
ggcatgagctattttttcccgccagaggtgatgggcagccatattggtgccagccattgt
cacagcacgcgccgtcgccatagcatcgagttccgtgggcttacggcactgttcggtcat
atggggattgagcttgatcctgtgaaagaagagcaagtggaaaaagaaggttttgagcgc
tatatcaagctgcacaaaatgctgcgtccactgctgcacagcggcagaacttggcgaatc
ccaactgatgataaagcgcatcaaattcacgcggtggtggccaacgatcaatcgcaagcg
gtggtgatgattgctcagctcgcgatgccgacgaactctttaagtgggcatttgcgcgta
ccgggtttagatccacaagcgacatatcgagtgacggtattggataaaccgtctaactac
gatgacatcgtgaattaccagccggcatggactgaatcgggctgcgaactgtctggcgca
tggtgtgaagaggttggtttaaccatgccaattcttgatgcagaaagtgcgatgttggtg
acgttcgaacgtattcactaa

DBGET integrated database retrieval system