KEGG   Vibrio vulnificus YJ016: VVA0166Help
Entry
VVA0166           CDS       T00150                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VVA0166
  Lipid metabolism
   00561 Glycerolipid metabolism
    VVA0166
   00600 Sphingolipid metabolism
    VVA0166
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VVA0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:193713..195833
Genome map
AA seq 706 aa AA seqDB search
MMTNKTVVELSGRETQLMVELGEYAEILHWGQKVSGDLSSFRMALHRPVPYGRLDTDVAM
TLHPELGRGVFSSPGVEGHREGQDWAPVFVISHVEHGQGSIVIQSEDAIAGLRLTTELML
DQHDVVKTRHTLTNIKAGLYQVNRLANTLPLPARANELMTYYGRWVHEFQTVRQPLLQGG
YQQENRRGRTSHEHYPALVAGSAHFDEMSGDVWGFHFAWSGNHRLRVDVKADGRRYMQAE
VIYLPGEVALKEGESLTTPWLYASYSRSGLNGMSHHFHSHVRDSILPEDFANKPRPIHLN
TWEGIYFDHDPDYIMSMATQSAEMGVERFIIDDGWFKGRNGDKAGLGDWFLCETKYPNGL
QPIVEHVNKLGMEFGLWFEPEMINKDSDLYRTHPDWLLAVEGYDQPTGRNQYVINLQNDD
AFNFLFERLDHFLSTYNIAYIKWDMNREVVQPSHLGQAAAHNQTQRYYQLVDKVREKHPN
VEIESCAAGGGRIDFEVLKRTHRFWASDNNDALERQTIQRGMSYFFPPEVMGSHIGASHC
HSTRRRHSIEFRGLTALFGHMGIELDPVKEEQVEKEGFERYIKLHKMLRPLLHSGRTWRI
PTDDKAHQIHAVVANDQSQAVVMIAQLAMPTNSLSGHLRVPGLDPQATYRVTVLDKPSNY
DDIVNYQPAWTESGCELSGAWCEEVGLTMPILDAESAMLVTFERIH
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaacaaaacagtggttgagttaagcggtcgggaaactcagttaatggtcgag
ctcggcgaatacgcggagattctgcactggggacaaaaagtaagtggtgaccttagtagt
ttccgcatggctttacatcgtcccgtgccatatggtcgccttgatactgatgtagcaatg
acactccatcctgagcttggccgcggtgtgttcagtagccccggtgtggaagggcatcgt
gaaggacaagattgggcacccgtgtttgtcatctcccatgttgaacacggccaaggttcg
atcgtgattcaaagcgaagatgcgatcgcaggccttcgcctgacaaccgagctgatgctg
gatcagcatgatgtggttaaaacgcgccacacactcaccaacattaaagcgggcctatac
caagtgaaccgcttggcgaacactttgcctttgcctgcccgtgcgaacgagttgatgacc
tattacgggcgctgggttcacgagtttcaaaccgtgcgtcaacctttgcttcaagggggc
taccaacaagagaaccgccgtggacgcacttcccatgaacattatccggcattggttgct
ggcagcgcgcattttgacgaaatgagtggcgatgtatgggggttccatttcgcatggagt
ggcaatcacagactgcgtgtggacgtgaaagctgacggtcgccgttatatgcaagcggag
gtgatctatcttccaggtgaagtggcactgaaagagggcgaaagcctgaccacgccgtgg
ttgtacgcaagttacagccgctcgggtctcaacggcatgagccaccatttccactcacac
gtccgtgattcgattttgcctgaggattttgcgaacaagcctcgtccgattcaccttaat
acttgggaaggcatctacttcgatcacgatccagactacatcatgtcaatggcaacccaa
tcggcggagatgggcgttgaacgctttattattgatgacggctggttcaaagggcgcaat
ggcgacaaagccgggctaggggactggttcttatgtgaaaccaagtatccgaatggtttg
caaccgatcgtcgaacacgtcaacaaactgggtatggagtttggtttgtggttcgaacca
gagatgatcaacaaagattcagatttgtatcgcacgcatcctgattggttattggccgtt
gagggttacgaccagccaaccggtcgcaaccagtatgtgattaacctgcaaaacgacgat
gcgtttaacttcctgtttgagcggttggaccatttcctctcgacttacaacatcgcttac
atcaaatgggacatgaaccgtgaagtggtgcagccatcgcatttaggccaagcggcagcg
cacaatcaaacccaacgttactaccagttagtcgataaagttcgcgaaaagcatccaaac
gtcgagattgaatcttgcgcggcgggcggtggccgtatcgattttgaggtactgaaacgt
acgcatcgattctgggcgtcagacaacaatgacgcacttgagcgtcaaaccattcaacgc
ggcatgagctattttttcccgccagaggtgatgggcagccatattggtgccagccattgt
cacagcacgcgccgtcgccatagcatcgagttccgtgggcttacggcactgttcggtcat
atggggattgagcttgatcctgtgaaagaagagcaagtggaaaaagaaggttttgagcgc
tatatcaagctgcacaaaatgctgcgtccactgctgcacagcggcagaacttggcgaatc
ccaactgatgataaagcgcatcaaattcacgcggtggtggccaacgatcaatcgcaagcg
gtggtgatgattgctcagctcgcgatgccgacgaactctttaagtgggcatttgcgcgta
ccgggtttagatccacaagcgacatatcgagtgacggtattggataaaccgtctaactac
gatgacatcgtgaattaccagccggcatggactgaatcgggctgcgaactgtctggcgca
tggtgtgaagaggttggtttaaccatgccaattcttgatgcagaaagtgcgatgttggtg
acgttcgaacgtattcactaa

DBGET integrated database retrieval system