KEGG   Vibrio vulnificus YJ016: VVA0572Help
Entry
VVA0572           CDS       T00150                                 

Definition
(GenBank) sugar kinase
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VVA0572
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VVA0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:643535..644491
Genome map
AA seq 318 aa AA seqDB search
MNKAHSRAEEYPMNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAA
ARLGADTGFIACVGDDSFGINIRENFKLDGIQIDGVKMQPNCPTGIAMIQVSDSGENSIC
ISAEANAKLTEAAIESDLPRIRDARFLLMQLETPICGIELAAREAKAAKTNVILNPAPAR
TLSDELLACIDVITPNETEAQVLTGIEVVDNESAQQAANVLHQKGIEIVMITLGSKGVWL
SENGRGQRICGFKVDVTDTTAAGDTFNGALVTGLLEDMPLESAIKFAHAAAAISVTRFGA
QTSIPTRKEVDEFLAAHS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctcattcaagagctgaggaatacccaatgaacaagttagtggttttaggt
agtgttaacgcagaccatgtgcttcaagtcccatccttcccacgtcctggggaaacgtta
catgggcgaaattatcaagtgattccgggtgggaaaggggccaatcaagccgttgccgct
gcacgtttaggcgcagatacgggcttcatcgcttgtgttggggatgactcgtttggcatc
aatattcgtgaaaacttcaagcttgacggtattcaaatcgatggcgtgaagatgcagccc
aattgcccaacaggcatcgcaatgattcaagtctcagacagcggcgagaacagtatttgt
atctcggcggaagccaatgccaaattaaccgaggcggccattgaatcggatttgccacgc
atccgtgatgccagatttcttcttatgcagttagaaacccctatctgcgggatagagctt
gcggccagagaagctaaagcggcaaaaactaatgtgattttaaatccagcaccagcgcgc
acattatccgacgagctactagcatgcatcgacgtgatcacaccaaatgagacagaagct
caggtgttaaccgggattgaggtagtggataatgaaagcgctcagcaagccgccaatgtc
ttacatcaaaaaggcattgagatcgtcatgattacgcttggctctaaaggggtttggctc
agcgaaaatggcagggggcaacgcatctgcggttttaaagtcgacgtcaccgatacaacc
gccgcgggcgatacttttaatggggcattggtcactggtttattggaggatatgccttta
gaatcagcgattaagtttgctcacgcagctgcggcgatttcagtgactcgatttggagcg
caaacttctattccaacccgtaaagaggtcgatgagtttttagccgcgcacagttag

DBGET integrated database retrieval system