KEGG   Vibrio vulnificus YJ016: VVA0935Help
Entry
VVA0935           CDS       T00150                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vvy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vvy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1029808..1030389
Genome map
AA seq 193 aa AA seqDB search
MDCCRHKYEAVVIGASAGGLAAVATVLQQLKDSFCIPILLVQHISASPESYIAAHFDSKS
HLSVHEAEDKQPIKNGNMYIAPPNYHMMIETDGCIALSVDPPVNFSRPSIDVLFETAADY
YRSALIGIVLTGANSDGALGLKKIKTLGGLTLVQSIDSAEAKAMPAAAMAAVDVDHILSL
EEIGHYLNTLCDC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggattgttgtaggcacaaatatgaagcagttgtaatcggggcatccgctggaggattg
gccgccgttgcaacggtattacagcaacttaaggattcattttgtatccctattttgttg
gttcagcatatcagtgcctctcctgagagttacattgccgcccattttgatagcaagagc
catttgtcggtccatgaagcagaagacaagcagccaatcaaaaacggcaacatgtacatc
gcaccacccaattaccatatgatgatagagaccgatggttgtatcgcactgtcggtcgat
ccgcccgtcaatttttcacggccttccatcgacgttctgttcgaaacggcggctgattac
tatagaagcgcgttgatcggtatcgtactgacgggggccaattccgacggtgccttaggt
ctcaaaaaaatcaaaacactgggtggactaactctagtccaatccattgatagtgcagaa
gcgaaagccatgcctgctgcggccatggctgccgttgatgtcgaccacatcctttctttg
gaagagattggtcattatttaaatactttatgtgattgctga

DBGET integrated database retrieval system