KEGG   Vibrio vulnificus YJ016: VVA0935Help
Entry
VVA0935           CDS       T00150                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VVA0935
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VVA0935
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VVA0935
Two-component system [BR:vvy02022]
 CheA family
  CheA-CheYBV
   VVA0935
Bacterial motility proteins [BR:vvy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VVA0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1029808..1030389
Genome map
AA seq 193 aa AA seqDB search
MDCCRHKYEAVVIGASAGGLAAVATVLQQLKDSFCIPILLVQHISASPESYIAAHFDSKS
HLSVHEAEDKQPIKNGNMYIAPPNYHMMIETDGCIALSVDPPVNFSRPSIDVLFETAADY
YRSALIGIVLTGANSDGALGLKKIKTLGGLTLVQSIDSAEAKAMPAAAMAAVDVDHILSL
EEIGHYLNTLCDC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggattgttgtaggcacaaatatgaagcagttgtaatcggggcatccgctggaggattg
gccgccgttgcaacggtattacagcaacttaaggattcattttgtatccctattttgttg
gttcagcatatcagtgcctctcctgagagttacattgccgcccattttgatagcaagagc
catttgtcggtccatgaagcagaagacaagcagccaatcaaaaacggcaacatgtacatc
gcaccacccaattaccatatgatgatagagaccgatggttgtatcgcactgtcggtcgat
ccgcccgtcaatttttcacggccttccatcgacgttctgttcgaaacggcggctgattac
tatagaagcgcgttgatcggtatcgtactgacgggggccaattccgacggtgccttaggt
ctcaaaaaaatcaaaacactgggtggactaactctagtccaatccattgatagtgcagaa
gcgaaagccatgcctgctgcggccatggctgccgttgatgtcgaccacatcctttctttg
gaagagattggtcattatttaaatactttatgtgattgctga

DBGET integrated database retrieval system