KEGG   Vibrio vulnificus YJ016: VVA0935Help
Entry
VVA0935           CDS       T00150                                 

Definition
(GenBank) putative protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy02020  Two-component system
vvy02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VVA0935
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VVA0935
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VVA0935
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     VVA0935
Two-component system [BR:vvy02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   VVA0935
Bacterial motility proteins [BR:vvy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VVA0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: BAC96961
UniProt: Q7MDV1
Position
II:1029808..1030389
Genome map
AA seq 193 aa AA seqDB search
MDCCRHKYEAVVIGASAGGLAAVATVLQQLKDSFCIPILLVQHISASPESYIAAHFDSKS
HLSVHEAEDKQPIKNGNMYIAPPNYHMMIETDGCIALSVDPPVNFSRPSIDVLFETAADY
YRSALIGIVLTGANSDGALGLKKIKTLGGLTLVQSIDSAEAKAMPAAAMAAVDVDHILSL
EEIGHYLNTLCDC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggattgttgtaggcacaaatatgaagcagttgtaatcggggcatccgctggaggattg
gccgccgttgcaacggtattacagcaacttaaggattcattttgtatccctattttgttg
gttcagcatatcagtgcctctcctgagagttacattgccgcccattttgatagcaagagc
catttgtcggtccatgaagcagaagacaagcagccaatcaaaaacggcaacatgtacatc
gcaccacccaattaccatatgatgatagagaccgatggttgtatcgcactgtcggtcgat
ccgcccgtcaatttttcacggccttccatcgacgttctgttcgaaacggcggctgattac
tatagaagcgcgttgatcggtatcgtactgacgggggccaattccgacggtgccttaggt
ctcaaaaaaatcaaaacactgggtggactaactctagtccaatccattgatagtgcagaa
gcgaaagccatgcctgctgcggccatggctgccgttgatgtcgaccacatcctttctttg
gaagagattggtcattatttaaatactttatgtgattgctga

DBGET integrated database retrieval system