KEGG   Vibrio vulnificus YJ016: VVA1022Help
Entry
VVA1022           CDS       T00150                                 

Definition
pyruvate dehydrogenase E1 component subunit beta
Orthology
K00162  
pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVA1022
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVA1022
   00020 Citrate cycle (TCA cycle)
    VVA1022
   00620 Pyruvate metabolism
    VVA1022
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     VVA1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1133481..1134464
Genome map
AA seq 327 aa AA seqDB search
MAELTLVEAVNLALHHEMERDANVVVLGEDVGDNGGVFRATVGLKQKFGLKRVMDSPLAE
ALIGGVAVGMATQGLRPVAEFQFQGFVFPAMEHLICHAARMRNRTRGRLTCPAVFRAPFG
GGIHAPEHHSESIEALFAHIPGFKVVIPSSPQRAYGLLLAAIRSDDPVMFFEPKRIYRTV
KSEVVDNGEALPLDSCFTLRKGRDVTLVTWGACVVESLQAAQTLSSQGIEAEVIDLASIK
PLDMATIFQSLEKTGRLLVVHEASRSGGVGGEIIARVAEQAMCLLKAPPKRVTGMDTVMP
YYRNEDYFMIQEQDIVLAARELMEGWK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactaaccctagttgaagcagtcaacctcgcccttcatcacgagatggagcgc
gatgcaaacgtcgtggtgcttggtgaagatgtgggagacaacggcggcgtgtttcgcgca
accgttggtctcaaacagaaatttggcctaaagcgcgtaatggactcaccactggccgaa
gcgttaattggtggcgtggcggtgggtatggcaacacaaggattgaggccggtggctgaa
tttcagtttcaaggctttgtgtttccagcgatggagcatctgatttgtcacgcggcaaga
atgcgaaaccgcactcgaggacgcctcacctgtcctgcggtgtttcgcgccccttttggc
ggcggtattcacgccccagagcaccactctgaaagtatcgaagcgctctttgctcatatt
cccggctttaaggtggtgattccttcttcacctcagcgcgcttacggccttttgctcgct
gccatccgcagtgatgatcctgtgatgttctttgaacccaaacgcatttatcgcaccgtc
aaatcagaggtggtggataacggcgaagcgctaccacttgatagctgtttcaccttacgt
aaaggccgcgatgtaaccctagtgacttggggcgcgtgcgtggtggaatctctgcaagct
gctcaaacgctctcttcacaaggcattgaggctgaagtgattgatttagccagtatcaag
ccgcttgatatggcgaccattttccaatctttagaaaaaaccggacgtttattggtggtg
cacgaggccagtcgcagtggtggtgtgggtggcgagatcattgcccgcgtcgctgagcag
gcaatgtgcttgctgaaagcaccacctaaacgcgtgacgggtatggataccgtcatgcct
tattaccgcaatgaggattacttcatgattcaagagcaagatattgtgctcgccgctcgt
gagcttatggagggctggaaatga

DBGET integrated database retrieval system