KEGG   Vibrio vulnificus YJ016: VVA1141Help
Entry
VVA1141           CDS       T00150                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VVA1141
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VVA1141
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VVA1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1267273..1269744)
Genome map
AA seq 823 aa AA seqDB search
MNKATLALLISGVLMVPITMAMAPNTDLVLMPYPQNVELSEGKVTLDKAFSIYIKGYDSP
RVAFNVKRTMERLYRQTGLPMLNWQAKSEQEATLVIDIQRAPSSAVQNIDSDESYQLKVA
NGKILLSSTEPYGTFHGLETLLQLVSTDANGYFVPAVAISDAPRFKWRGVSYDTARHYIE
LPVILRQLDAMASAKMNVFHWHIWDDQGIRIQLENYPRLWQATADGDFYSKDEIRQVVEY
ARNLGIRVIPEISLPGHASAVAHAYPELMSGLGEQSYPQQRGWGVFEPLMDPTNPELYTM
LASVFDEVVELFPDEYFHIGGDEPNYQQWRDNPKIQAFIKQHQLDGERGLQSYLNSRVEQ
MLNQRGKKITGWDEIWHKDLPKSVVIQSWQGHDSIGRAAKEGYQGILSTGYYLDQPQPTS
YHYRNDPMPKGITVDDQLHQGEKFVTYDWVKPRNKGGPRKGNLTIIEGADGKVRAFTDYN
GKSREEVYVLEYVPGVMFRGHFDNFMSYTEFNYQFAGDQLKEGSYQRIGNVRWPATGNLV
ASSEGEVTSIPQPNGGYPAQLTKEEEPLILGGEVTIWGENLDSMTIEQRLWPRSYAIAER
LWSSESLTDEASMYRRMRALDSWSEISLGLRHHADARMMLQRLANGADVAPLITLAKYTE
PAQYYARHWEKWISTPNKGDLYNQYERLNRFADALVVESYAVYDMEALVRGYQPNDNAQS
PQSKQALEELSEHYQAVKGAARQSRGIFAANVASRESVAIADATIALAELGLELVEKAQQ
GQVLSAAERATYQAILDKNAVIFDETIVAIVRPTEQLLHKIAP
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctacactggctctactgatttcaggcgtactgatggtaccgataacgatg
gcaatggctcccaataccgatttggttttaatgccttacccgcaaaacgttgagttaagc
gaaggcaaggtgacgctggataaagcgttcagtatttatatcaaaggttacgactcaccg
cgcgtggcgtttaacgttaagcgcaccatggagcggctctatcgacaaactggcttgccg
atgctgaattggcaggcaaaatccgaacaagaagcaacgttggtgatagatattcaacgt
gccccaagcagtgcggtgcaaaatatcgacagcgatgagtcataccaattgaaggttgcc
aatggcaagattttgctttcatccactgagccttatggcacgtttcatggcttagaaacc
ttactgcaactggtttcgacggatgccaatggttactttgttcccgccgttgctatctct
gatgcgccacgttttaaatggcgtggggtgtcgtacgatactgcgcgtcattacatcgaa
ctgccagtgattttacgccagttggatgccatggcctcagcgaaaatgaacgtcttccac
tggcatatctgggatgaccaaggcattcgtattcaactggaaaactaccctcgcttgtgg
caagccaccgcggatggtgatttctacagcaaagatgaaattcgccaagtggttgagtac
gcgcgtaatcttggtattcgtgtcatccctgaaatctcgctgcccggccacgcgtcggca
gtcgcgcacgcctatccggaattgatgtctggccttggtgaacagtcttaccctcagcag
cgaggttggggtgtgtttgaacctttgatggacccaaccaatccggagctctacaccatg
ttggcaagcgtattcgatgaagtggtcgagctcttcccagatgagtattttcacatcggc
ggggatgagccgaactatcaacagtggcgtgacaacccgaaaatccaagcgtttatcaaa
cagcatcaattggacggcgaacgagggctgcaatcgtacctgaatagccgagtcgagcag
atgctgaaccagcgcggcaagaaaatcacaggctgggatgaaatttggcataaagatctg
ccgaaatcggtggtgattcagagttggcaggggcatgacagtattggccgagcggcgaaa
gagggctatcaaggtattttgtcgacgggttattatctcgatcagcctcaacccaccagc
taccactatcgtaatgacccgatgccgaaggggatcaccgtcgatgatcaactgcatcaa
ggggaaaaatttgtcacctacgattgggtgaagcctcgcaataaaggaggcccgcgcaaa
gggaatctcaccatcatcgagggtgctgatggcaaagtgcgtgcgtttaccgattacaat
ggtaaatcgcgtgaagaagtgtatgtattggaatacgtgcccggcgtgatgttccgtggc
cattttgacaacttcatgtcctacacagagttcaattatcagtttgctggtgatcaacta
aaagaaggcagctatcagcgtattggtaatgtgcgttggccggcaactggcaatttggtg
gcgtctagcgagggagaagtgacgagcattccgcaacccaatggcggttatcctgctcaa
ctgaccaaagaagaggagccattgatcctcggtggtgaagtgaccatttggggtgagaat
ctcgattcgatgaccatagaacagcgcttatggccacgcagctatgcgattgccgaacga
ctttggtcaagtgaatcgctcactgatgaagccagtatgtaccgtcgaatgcgtgcgttg
gacagttggtcggaaatttctcttggcctgcgtcatcatgcggatgctcggatgatgcta
cagcgtttagccaatggagcagacgttgcaccgctcatcacgttagccaaatacacggag
cctgcacaatattatgcgaggcactgggagaaatggatttctacgccaaacaaaggggat
ttgtacaaccaatatgaacgcttaaatcggttcgccgatgccctcgtggtagaaagctat
gcggtgtatgacatggaagcgttggtgcgtggctatcagccaaatgacaatgcgcaaagt
ccacaaagcaagcaggcgcttgaggagctttctgagcattatcaggcggtgaaaggtgca
gcgcgccaatctcgtgggatttttgctgccaatgtggcctcacgtgagagtgtggcgatc
gcagatgcaaccatagcgttagcggaactgggtcttgagttggtggaaaaagcgcaacag
ggacaagtgctttcagctgctgagcgagcgacttatcaagcgatattggataagaatgcg
gtcatttttgatgaaaccattgtggcgatagtaagaccaaccgagcagctacttcacaaa
attgcaccttag

DBGET integrated database retrieval system