KEGG   Vibrio vulnificus YJ016: VVA1393Help
Entry
VVA1393           CDS       T00150                                 

Definition
sucrose phosphorylase-like protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vvy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1543268..1544965)
Genome map
AA seq 565 aa AA seqDB search
MIANSIYNKVAKLYGEASATKITDDILALMKKWQDKAPQYQSWVDQRTSYLITYGDSFST
QAEPTLATMKTFADRHLKGALSNIHILPMFPYTSDDGFSVVDYRQVDPNLGDWDQLNALS
ENFDLMYDCVINHISKSSDWFQGYLAGDAKYQDYFVESDPSLDYSSVTRPRALPLHTPFS
KASGETVHVWTTFSDDQIDINFHSPKVLLESIDILLMYAANGGRSIRLDAIGFIWKKLGT
TCIHLEEAHEIIKLWRIILDEVMPGTLLITETNVPHKENVSYFGAGDEAHMVYQFPLPPL
TLHALMSENSETLTQWATSLTNEAMARLAQGDKTTYFNFLASHDGIGVRPTEGILTDEDR
QMMCAQVERKGGRVNYKNNGDGTQSPYELNINYLSAITEPTDSIDDKAKKFIAAQSILLS
FIGVPAIYYHSLLGSENDVQGMLDSGINRRINREKLDLSKLESELADEDSLRSKVFKSMT
HLLNLRQQYAAFSPQASQQVLNLGDGIFALQRGDGEEAIRFAVNLTSQAQAVVLADSGFD
LISEQLMPAEFELAPYQFVWLTQQK
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgattgctaattcgatttacaacaaagttgccaagctgtatggcgaggccagcgcgaca
aaaattaccgatgatattcttgctttaatgaaaaagtggcaagacaaagcaccgcaatat
caaagttgggtggatcaacgtacctcttacttgatcacctacggcgacagtttttctact
caagcagaacccacgctggcgacgatgaagacattcgctgatcgtcatttgaaaggggca
ttgagcaacattcatattttgccaatgttcccttacacctcggatgatggttttagtgtg
gttgattaccgtcaggtggatcctaatctcggtgattgggatcaattgaatgcactatct
gagaactttgacctgatgtacgactgtgtcatcaaccatatctctaagagcagcgattgg
ttccaaggttacctagcgggtgatgcgaaataccaagactactttgtagagtctgatccg
agccttgactattcaagtgtaacgcgcccccgtgcgttaccgctccacactccgtttagc
aaggcatcgggtgagactgtacatgtgtggacgactttctcggacgatcaaatcgacatt
aacttccacagcccgaaagtgcttttagaaagcatcgatatcttgttgatgtacgcggcg
aatggtggacgttcgattcgtcttgatgcgattggttttatctggaaaaagctcggaacc
acatgtattcatctagaagaagcgcatgaaatcatcaagctatggcgaatcattttggat
gaagtgatgccagggacattgttgatcactgagaccaatgtgccgcacaaagagaatgta
tcctactttggggctggcgatgaagcgcacatggtttatcaattcccactgccgccatta
acgctgcacgctttgatgagtgaaaatagcgagacattgacgcaatgggcgacttcgctg
acaaatgaagcgatggcgcgactcgctcaaggtgataaaactacgtactttaacttcctt
gctagccatgatgggattggggttcgtccaacggaaggcatactgaccgatgaagaccgc
caaatgatgtgcgcgcaagtcgagcgcaaaggcggtcgagtgaactacaaaaataacggt
gatggaactcaatcaccttatgagttgaatattaactacctcagcgcaattaccgagccg
actgacagcattgacgacaaagcgaagaagttcatcgcagctcaatctatcttactgtca
ttcatcggtgtacccgcgatttattaccacagcttgttgggtagcgaaaatgatgtgcaa
ggtatgctcgattcagggattaaccgacgcatcaaccgtgaaaaattggatttatctaag
ctagaaagtgagttggcagatgaagactcactgcgctcaaaagtattcaagtcaatgacg
cacttattgaaccttcgtcagcaatacgccgcattctcaccacaggcttctcaacaagtc
ttgaatttgggtgatggtatctttgcattgcaacgtggcgatggtgaagaagccattcga
tttgcggttaatcttacatcacaagctcaagctgttgtgttagcggattctggctttgac
ctgattagtgaacagttgatgccagcagaatttgagttggcgccttaccagtttgtttgg
ctgacacagcaaaaataa

DBGET integrated database retrieval system