KEGG   Wolbachia wBm (Brugia malayi): Wbm0179Help
Entry
Wbm0179           CDS       T00234                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00900  Terpenoid backbone biosynthesis
wbm01100  Metabolic pathways
wbm01110  Biosynthesis of secondary metabolites
wbm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Wbm0179
Enzymes [BR:wbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Wbm0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom PurA TBSV_P22
Motif
Other DBs
NCBI-ProteinID: AAW70770
UniProt: Q5GTA4
Position
complement(228435..229604)
Genome map
AA seq 389 aa AA seqDB search
MKKISVLGSTGSIGKKTVDLLLKRKEEYQVEALSTCSNFALLACQAKLLNARYVAISNKR
FYKDLKESLLGTGIKVEVGTEGLMNVASLPVDLSVVAVVGIAGLEPVMHVIESGTKVIAL
ANKESIVCGGKLLLKKTEEKNVQIVPIDSEHNAIFQVLQNGNKCVEKIILTASGGSFLNY
SLEQLRNVTVGQALSHPTWNMGKKISVDSATMMNKALEIIEAHNLFNISPNRIEAIVHPE
SIIHGIVIYKDGFNFAVLAEADMAIPISYALSWPERSALSYKLDLTKQKLTFQEPDHKRF
PALKLSMEVLNSSSPHTNSIVLNAANEVAVDKFLKSRIDFLEIIKVVKLTVENFDSYTDI
NSLSDIINIDLESRAIAKEIIKNKVLAYS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagatttcagttttaggatcgacaggaagtattggaaaaaagactgtagattta
ctattaaagagaaaagaagaatatcaagtagaagcactcagtacctgttcgaattttgct
ctactggcatgccaagcaaaactgctaaatgcaaggtatgttgctatctctaataaaagg
ttttataaagatttaaaagaaagtctacttggtacgggcatcaaagtagaagttggtact
gagggtctaatgaatgttgcttctctgcccgttgatctctcagttgttgcagtagttggt
attgcaggccttgagccagtaatgcacgtcatagaaagtggtactaaagtcattgcacta
gcaaacaaagaaagtattgtttgtggtggaaaactattacttaagaaaaccgaagaaaaa
aacgtacagatagttcctattgactctgaacacaatgcaatttttcaagttttgcagaat
ggcaataaatgtgtagaaaagattatactcactgcttctggtgggtcattcttgaattat
agccttgagcaattaagaaacgttacagtaggtcaagcacttagtcatcctacttggaac
atgggaaagaaaatctcagttgatagtgcaactatgatgaacaaagcgctggagataata
gaagcacataatttatttaatattagcccaaacagaattgaagcaatagtgcatcccgaa
tcgataatacatggaattgtaatttataaggatggttttaattttgctgtacttgcagag
gctgatatggcaattcccatttcatatgctctgtcttggccagaaaggtcagctttaagt
tataaattagatttaacaaagcagaaattgacctttcaagaaccggaccataagcgcttt
cctgcgctaaagcttagtatggaagtgttaaattcctcctctccacacacaaatagcata
gtacttaatgctgcaaatgaggtagctgttgataaatttttaaaatcacgaattgacttt
ttggagataataaaagtagtaaagttaacagtagagaattttgatagttacactgacatt
aactcattatccgatataataaacattgatcttgaaagccgtgctattgcaaaagaaatt
atcaaaaataaagttcttgcgtatagctaa

DBGET integrated database retrieval system