KEGG   Wolbachia wBm (Brugia malayi): Wbm0251Help
Entry
Wbm0251           CDS       T00234                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Wbm0251 (ruvA)
Enzymes [BR:wbm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Wbm0251 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318469..319059
Genome map
AA seq 196 aa AA seqDB search
MIGNLSGTVDEVYGDHIILNVNDVGYIIYLSAKALNVCYIGSKIKLLIETCANNRENTTQ
LYGFINKEEQSCLRLLVKVSGVSYKTAMSILSKLTPEQLFLAIMNEDKIALKISGLGPKL
INRIITELSGKVSKLETNNNNFYPINEDAVSALINLGYEKTKVYDTIKKYKPNLDTKDII
RTALKELSNYEIDIMQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaatttaagcgggacagtagatgaagtttacggcgatcacataatcctgaat
gtaaatgatgttggctatataatatacctttcagccaaagctttaaatgtatgttatata
ggaagtaaaatcaagttacttatcgaaacttgtgcaaacaacagagaaaacaccacgcag
ctatatggttttataaataaggaagaacaatcatgcttgcgtttgcttgttaaggtgagc
ggcgttagctataaaactgcaatgtcgatcctgagcaaattaaccccagaacagctattt
ttagcaattatgaatgaagataaaatagcactcaagataagcgggcttggtccaaaactc
ataaatcgaattatcactgaattgagtggcaaagtgagcaaattagaaacaaataacaac
aatttctatccaattaacgaggatgccgtttcagcattgatcaatcttggatatgaaaaa
acgaaagtttatgataccataaaaaagtacaaaccgaatctggatactaaggatattatt
cgcacagcgcttaaggagctttcaaattatgagatcgatatcatgcagtaa

DBGET integrated database retrieval system