KEGG   Wolbachia wBm (Brugia malayi): Wbm0251Help
Entry
Wbm0251           CDS       T00234                                 

Definition
(GenBank) Holliday junction resolvasome, DNA-binding subunit, RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Wbm0251
Enzymes [BR:wbm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Wbm0251
DNA repair and recombination proteins [BR:wbm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Wbm0251
    RecFOR pathway proteins
     Wbm0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
318469..319059
Genome map
AA seq 196 aa AA seqDB search
MIGNLSGTVDEVYGDHIILNVNDVGYIIYLSAKALNVCYIGSKIKLLIETCANNRENTTQ
LYGFINKEEQSCLRLLVKVSGVSYKTAMSILSKLTPEQLFLAIMNEDKIALKISGLGPKL
INRIITELSGKVSKLETNNNNFYPINEDAVSALINLGYEKTKVYDTIKKYKPNLDTKDII
RTALKELSNYEIDIMQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaatttaagcgggacagtagatgaagtttacggcgatcacataatcctgaat
gtaaatgatgttggctatataatatacctttcagccaaagctttaaatgtatgttatata
ggaagtaaaatcaagttacttatcgaaacttgtgcaaacaacagagaaaacaccacgcag
ctatatggttttataaataaggaagaacaatcatgcttgcgtttgcttgttaaggtgagc
ggcgttagctataaaactgcaatgtcgatcctgagcaaattaaccccagaacagctattt
ttagcaattatgaatgaagataaaatagcactcaagataagcgggcttggtccaaaactc
ataaatcgaattatcactgaattgagtggcaaagtgagcaaattagaaacaaataacaac
aatttctatccaattaacgaggatgccgtttcagcattgatcaatcttggatatgaaaaa
acgaaagtttatgataccataaaaaagtacaaaccgaatctggatactaaggatattatt
cgcacagcgcttaaggagctttcaaattatgagatcgatatcatgcagtaa

DBGET integrated database retrieval system