KEGG   Wolbachia wBm (Brugia malayi): Wbm0408Help
Entry
Wbm0408           CDS       T00234                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Wbm0408
   01230 Biosynthesis of amino acids
    Wbm0408
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Wbm0408
   00051 Fructose and mannose metabolism
    Wbm0408
   00562 Inositol phosphate metabolism
    Wbm0408
Enzymes [BR:wbm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Wbm0408
Exosome [BR:wbm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Wbm0408
  Exosomal proteins of bladder cancer cells
   Wbm0408
  Exosomal proteins of melanoma cells
   Wbm0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529449..530150
Genome map
AA seq 233 aa AA seqDB search
MSFLIVANWKMNGTRSLFVNFIGKLNDKSNEITSKLVICPPFTSLPGNIELNSNISIGAQ
NCHYKKSGSYTGEISAEMLKELGCTYVILGHSERTHETNGEIKLKSETAIESGLHPIICV
GENLEDRESSKTKEVVEYQCKSRLPIHGEYTVAYEPIWAIGTGHVPSNNAIAEVIEVIQS
YTSKKHVIYGGSVSLENIENLSNILNLSGVLIGSASLDFDRFHKIVQQVEKAY
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttttaatagtcgcaaattggaagatgaatggaacacgctctttattcgtcaac
tttataggtaaactcaatgacaagagtaatgaaattacttctaagctcgtgatttgccca
ccttttacatcacttccaggtaatatagagctgaatagtaatattagtataggagcacag
aattgccattataaaaagtctggttcttatacaggtgaaattagcgcagagatgctaaaa
gagttaggatgtacttacgtaatacttgggcattccgaaagaactcacgaaacaaatggt
gaaataaagcttaaatcagaaacagctatagaatcgggcttacacccaattatttgtgta
ggtgaaaatttagaagaccgtgagagtagtaaaacaaaggaagtagtagagtatcaatgc
aaaagccgcttgccaatacatggtgaatataccgtagcatatgaaccaatatgggcaata
ggtacaggacatgtaccaagtaataatgcaattgctgaggtaatagaagtgatacaatct
tatactagcaaaaaacacgttatatatggcggctcagtcagtttagaaaatatagaaaat
ttatcgaatatcttgaatttatcaggagttttaattggcagtgcaagcttagattttgat
cgctttcataaaattgtacagcaagttgaaaaagcctattaa

DBGET integrated database retrieval system