KEGG   Wolbachia wBm: Wbm0408Help
Entry
Wbm0408           CDS       T00234                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wbm  Wolbachia wBm
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:wbm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:wbm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:wbm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:wbm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:wbm00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529449..530150
Genome map
AA seq 233 aa AA seqDB search
MSFLIVANWKMNGTRSLFVNFIGKLNDKSNEITSKLVICPPFTSLPGNIELNSNISIGAQ
NCHYKKSGSYTGEISAEMLKELGCTYVILGHSERTHETNGEIKLKSETAIESGLHPIICV
GENLEDRESSKTKEVVEYQCKSRLPIHGEYTVAYEPIWAIGTGHVPSNNAIAEVIEVIQS
YTSKKHVIYGGSVSLENIENLSNILNLSGVLIGSASLDFDRFHKIVQQVEKAY
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttttaatagtcgcaaattggaagatgaatggaacacgctctttattcgtcaac
tttataggtaaactcaatgacaagagtaatgaaattacttctaagctcgtgatttgccca
ccttttacatcacttccaggtaatatagagctgaatagtaatattagtataggagcacag
aattgccattataaaaagtctggttcttatacaggtgaaattagcgcagagatgctaaaa
gagttaggatgtacttacgtaatacttgggcattccgaaagaactcacgaaacaaatggt
gaaataaagcttaaatcagaaacagctatagaatcgggcttacacccaattatttgtgta
ggtgaaaatttagaagaccgtgagagtagtaaaacaaaggaagtagtagagtatcaatgc
aaaagccgcttgccaatacatggtgaatataccgtagcatatgaaccaatatgggcaata
ggtacaggacatgtaccaagtaataatgcaattgctgaggtaatagaagtgatacaatct
tatactagcaaaaaacacgttatatatggcggctcagtcagtttagaaaatatagaaaat
ttatcgaatatcttgaatttatcaggagttttaattggcagtgcaagcttagattttgat
cgctttcataaaattgtacagcaagttgaaaaagcctattaa

DBGET integrated database retrieval system