KEGG   Wolbachia wBm: Wbm0568Help
Entry
Wbm0568           CDS       T00234                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
wbm  Wolbachia wBm
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:wbm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:wbm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(743117..744322)
Genome map
AA seq 401 aa AA seqDB search
MKIDPVELTKKLISFKSITPRDDGAIEHIAAILEKSGFDCEILEFGDNKTKVKNLYAKYI
NGVQNLCFAGHVDVVPPGQLKDWISDPFSPEVRDGLLYGRGATDMKSGIAAFITAMVDLV
AEKFRFNGSISALITSAEESTEEYGTKAVLKWMESKHKKIDYCVVAEPTSSEKLGDTIKI
GRRGSATFELICHGKQGHVAYPDLADNPIYKMISILNRIKDTTFDGGNKYFQPSNCEITT
IDVGNSTDNVILDSITAGFNIRYNNMQTPDGLYKLIDEICFSVTNDYKLSMHSSRGAFLS
TPDRNTDVMFDAINKVTNIDAVLATSGGTSDAAFIKDVCPVIEFGMINKTSHQVNECVLV
NDIHKLTAIYKEFIKSYFYPTNRILNQINVIGNVPDSPLLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgatcctgtagagctaactaagaaattaatttcttttaagagtataacacca
agggacgatggagcaatagagcatatagcggcgatcctcgagaaaagtggttttgactgt
gagattttagagtttggtgataataaaactaaagttaaaaatctttatgcaaaatatata
aacggggtacaaaatttgtgttttgcaggccatgttgatgttgtaccaccaggtcaatta
aaagattggatatctgacccgtttagtccagaagttagggatgggttgttgtatgggaga
ggggcaactgacatgaaaagcgggatagctgcgtttattactgctatggtagatttagtt
gcagaaaagtttagattcaacggttcgataagtgcgttgattaccagtgctgaagaaagt
acggaagaatatggaacaaaggcggttttgaaatggatggagagtaagcataagaaaata
gattattgtgtagttgctgaaccaaccagtagtgagaaattaggtgatactataaaaata
ggcagaagaggttctgcaacatttgagctaatttgccatggaaaacaagggcacgttgct
tatccggatctagcggacaatccaatatataagatgatatcaatattgaataggataaaa
gatactacttttgacggcggtaataaatattttcagccttcaaattgcgaaattactact
atcgatgttggaaacagtactgacaatgtaatacttgattcaataactgcaggcttcaac
attagatacaacaatatgcaaacacctgatggtttatataagttgattgatgaaatatgc
ttcagtgtaactaacgattataaactctctatgcatagcagcaggggtgcttttctttct
actcccgatagaaatactgatgttatgtttgatgcaataaacaaagttaccaatattgat
gctgtgctggctacaagtggtggcacatctgacgctgcatttattaaagatgtttgtcca
gtgattgaatttgggatgattaataaaacctcacatcaggtaaacgagtgtgtattagtg
aacgatatacacaaattaacagctatatataaggaatttataaaaagttatttttacccc
actaataggatattaaatcagattaatgtaattggtaatgtacctgatagcccattgtta
gcttga

DBGET integrated database retrieval system