KEGG   Wolbachia wBm: Wbm0668Help
Entry
Wbm0668           CDS       T00234                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
wbm  Wolbachia wBm
Pathway
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:wbm00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(871925..873295)
Genome map
AA seq 456 aa AA seqDB search
MKVEDKKAVKSFFKIFGGVADTVRSWIGNIGPDLSSSRDIDSLILKMNECLNPKGGEVSA
RKNTVSLGNLYLSLSEKGRIKFLQTLAEKFNPSKAEIDEKIKGYKKNQDSELSYKFEQDL
IRILESPRSKILKQFISLPEGLKFIVDMRSDVLKLKSQYRSLNPLENELKSILCTWVDVD
LLDLRQITWDSPASLLEKLIKYEAVHKISSWGDLKNRLDSDHLCFAFFHYKIPSEPLIFV
EVALMNEIANSIQHLLDESIPSSDPSNASTAIFYSISNTQAGLSGISLGNFLIKRVVEKL
SHEFKSIKVYATLSPIPGFAKWLKENLNQDITLLSKLNIKQSSAEILGNIGQLKTNVECE
SEVKQCLLKLCAHYLLKVKNSNGSAYDPVAHFHLSNGASIKQLNWMADTSEKGIGQSAGI
MVNYLYELSKIDNNHESYMVNKVVSHSKKVSSILKE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttgaagataagaaagcagtaaaaagcttttttaagatatttggtggagtggca
gatactgtaagatcgtggattggcaatattggtccggatttaagcagtagtcgcgatatc
gatagtttaattttaaagatgaacgagtgcttaaatccaaaagggggggaagtctcggcg
cgtaagaatactgtatctcttggtaatctgtacttaagtttatcagagaaaggtagaata
aagtttctacaaaccctggcagaaaaatttaatccaagcaaagcggaaatagatgaaaaa
ataaaaggatataagaaaaatcaagattccgaattgagctataaatttgaacaggactta
ataagaattcttgaatcgccacgttctaaaatattgaaacagtttatctctttaccagaa
ggtcttaagtttattgttgacatgcgttctgatgtgcttaagctaaagagccaatataga
agtctaaatccgctagagaacgaattaaaaagtatactttgtacttgggttgatgttgat
ctattggatcttcgtcaaataacctgggattcacctgcatcattgttggaaaaacttata
aaatatgaagctgtgcataaaatttcttcgtggggtgacttaaaaaacaggctagattct
gatcatctctgttttgctttttttcattataaaataccaagtgaacctttaatttttgta
gaggttgcattgatgaatgaaatagcaaatagtattcaacaccttttagatgagtcaata
ccttcaagcgatccaagtaatgcaagcactgccatattctattcaatatcaaatacccaa
gcagggttgtctggaatcagtcttggtaattttttgatcaaaagggttgtggaaaaatta
tcgcatgaatttaaaagcataaaggtgtacgcaactctttctccaatacctggctttgca
aaatggctaaaagaaaatttaaaccaggatattactttgttaagcaaactgaatataaaa
caatctagtgcagaaattttaggaaatataggtcaattgaaaactaacgttgaatgcgaa
agtgaagtaaaacaatgcttgctgaagctttgtgcgcattatttgctaaaggttaaaaac
agcaatggcagtgcttatgatccagtggcgcattttcatttaagtaatggtgcatcgata
aaacaactaaactggatggcggatacctctgaaaagggtataggccaatcagctgggata
atggtgaactatttgtatgaattatctaaaatagataacaatcatgagagttatatggtt
aataaagtagtttctcactcaaaaaaagtgtcgtctatattaaaggagtaa

DBGET integrated database retrieval system