KEGG   Wolbachia wBm: Wbm0740Help
Entry
Wbm0740           CDS       T00234                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
wbm  Wolbachia wBm
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:wbm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:wbm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968818..970095
Genome map
AA seq 425 aa AA seqDB search
MHKILVRSNYKPLVGQIKINGSKNAILPIMAASLLSSSSVVLHNVPDLIDVHLMSELLEG
LGAKVNFMHNKDHKANHTLETDCSNINNYAIQYETASKLRASFLMLGPMLSRFGKARTAF
PGGCNIGKRPVDMHIKALEEMGAKIEIDGYNIIATVKGKLQGRKITLEKISVGATENIIM
AATLAEGVTTINNAATEPEILDLIEFLKKIGADIKINNTKVIITGVKKLNGCIHKIISDR
IEAGTYALAAIITNGKLVLEGINLSDIRCIANELEAIGAMVELYDGSIVISRKNGSIKST
NVATDPYPNFPSDMQPQLMSAMCIADGISVIEENIFENRFSHADELRKLGANISIKKNKA
AINGIKSLSGANLYATDLRSTAALVLASLVASGETTINNSHHLWRGYEAMHEKLNSCGAD
ISISP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatattagtaaggagtaactataaacccttggttggacaaatcaagattaat
ggttcgaagaatgctattttgccaataatggcagctagcctcttgagtagttcttcagta
gttctacataatgtacctgatctaattgatgtgcacctgatgtctgaattgcttgaaggt
cttggagcaaaagtaaactttatgcacaacaaagatcacaaagcaaatcatactttggaa
actgattgcagtaacatcaacaattacgcgatacagtatgaaactgcaagcaaactacga
gcttcttttctaatgttgggcccaatgcttagtagatttggcaaagcgagaacagctttt
cctggtggatgcaatatcggaaagcgtcccgttgatatgcatatcaaagcgttagaagaa
atgggagctaaaattgaaattgatggctataatataattgcaacagtgaaaggaaagcta
caaggaagaaaaatcacacttgagaaaataagcgtcggtgcaacagaaaatataataatg
gcagcaacacttgcagaaggagtaacaacaataaataatgctgcaactgagccagaaatt
cttgatttaatagagtttctaaagaaaataggtgctgatattaaaatcaataatacgaag
gttataataacaggagttaaaaaattaaatgggtgtatccacaaaataatatcagatcga
atagaagccggtacgtatgcattagctgctatcataactaacggtaagctggtgttggaa
ggaatcaatctatctgacatcagatgtattgcaaatgagttggaagctataggagctatg
gttgaactgtacgacggaagcattgtcatttccagaaaaaatggttctattaagtctact
aatgttgcaacagatccataccccaacttccccagtgatatgcaaccacaactgatgtcc
gcaatgtgcatcgctgacgggatatcagtaattgaagaaaacatttttgaaaataggttt
tcacatgcagatgaattaagaaagttaggtgctaatattagcattaagaaaaacaaagct
gctataaatggaataaaaagcttatctggagctaatctatatgctactgacttaagatca
actgcagctttagtgcttgcttctttagtagccagtggagaaaccacaataaataactca
catcatttatggagagggtatgaagcaatgcacgaaaaacttaattcatgcggggccgat
atctctatttcaccttga

DBGET integrated database retrieval system